LXL04_022146 | RubberDandelionOmics

Gene overview

LXL04_022146

Reference: OH-1004 Chr: Chr04 Coordinates: 145292916-145293653 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · LXL04_022146|LXL04_022146|OH1004|cDNA

ATGTCGAGGGAATTCAACGTCCCCCCTGTGATTTTCCCATCCGGTGGAAACCCTAACACCGGTCCTCAACGACGGCTCCCCACTGCTCCATTTCAGCCACCGAGATCCTCAAACCCTAGCATCCCTTTCATGTCCTTCGACATCGGCTCCTCTCCAGCATCCACTTCCTTCGCAACTCCTCAATTTGGCAGCATCGGAAGCGGTAGCGCGAACTTCGACGACGAACCGCCTCTCCTTGAAGAGCTTGGTATAAACACCAA...

CDS

Download CDS FASTA

738 bp · LXL04_022146|LXL04_022146|OH1004|CDS

ATGTCGAGGGAATTCAACGTCCCCCCTGTGATTTTCCCATCCGGTGGAAACCCTAACACCGGTCCTCAACGACGGCTCCCCACTGCTCCATTTCAGCCACCGAGATCCTCAAACCCTAGCATCCCTTTCATGTCCTTCGACATCGGCTCCTCTCCAGCATCCACTTCCTTCGCAACTCCTCAATTTGGCAGCATCGGAAGCGGTAGCGCGAACTTCGACGACGAACCGCCTCTCCTTGAAGAGCTTGGTATAAACACCAA...

Protein

Download Protein FASTA

245 aa · LXL04_022146|LXL04_022146|OH1004|PROTEIN

MSREFNVPPVIFPSGGNPNTGPQRRLPTAPFQPPRSSNPSIPFMSFDIGSSPASTSFATPQFGSIGSGSANFDDEPPLLEELGINTKQIWNKTVSILNPFRVKADLHEDADLSGPFLFLMAFGLFQLLAGKLHFGIILGWVTVASLFLYIVFNMLAGRNGNLDLYRCLSLIGYCLLPIVILSAVALFVPQGGLVIFIMMGIFVIWSTRVCTRLLVELASCGDEHRGLIAYACFLIYMLFSLLVVF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022146`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_022146`
Location	Chr04:145292916-145293653 (+)
Description	Similar to yipf5: Protein YIPF5 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022146` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0007030 Golgi organization Biological Process GO:0015031 protein transport Biological Process GO:0030070 insulin processing Biological Process GO:0048280 vesicle fusion with Golgi apparatus Biological Process GO:0060628 regulation of ER to Golgi vesicle-mediated transport Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005801 cis-Golgi network Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0030134 COPII-coated ER to Golgi transport vesicle Cellular Component
KEGG gene cross-reference	ddi:DDB_G0283541 hsa:285525 mmu:75581 pon:100174636 xtr:493343 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.608

Rank 1 · LXL04_022146 · OH-1004

Endoplasmic reticulum0.389

Rank 2 · LXL04_022146 · OH-1004

Cytoplasm0.150

Rank 3 · LXL04_022146 · OH-1004

Nucleus0.060

Rank 4 · LXL04_022146 · OH-1004

Cell membrane0.051

Rank 5 · LXL04_022146 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04893.23Yip1112-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022146	`PF04893.23`	Yip1	112	243	2.4e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card