TkA04G114780 | RubberDandelionOmics

Gene overview

TkA04G114780

Reference: TK1151 Chr: Chr04 Coordinates: 29818388-29818890 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA04G114780|TK1151|cDNA

ATGGCGTCATCTGTCTCGAGCGTATCTGGTGGTGGTCGATCAAGAAGGCAAGGAATTAGGTCAAGGTGTGGTTGTGGCGATCTCGTTGGCTCGTGGACATGTTGGAAGTCAACACACCCGGGAAGAAGGTTTGTAGGCTGCCCTAACTTCCGACAGAAGAAGAGTTGTGGCTACTTTTTTTGGATTGACCCCGAATTGCCAAACCAGTGGTACAAAGACACCATGTTTAATATGTACCACCATGGGGGAGAAATTGAAGA...

CDS

Download CDS FASTA

432 bp · TkA04G114780|TK1151|CDS

ATGGCGTCATCTGTCTCGAGCGTATCTGGTGGTGGTCGATCAAGAAGGCAAGGAATTAGGTCAAGGTGTGGTTGTGGCGATCTCGTTGGCTCGTGGACATGTTGGAAGTCAACACACCCGGGAAGAAGGTTTGTAGGCTGCCCTAACTTCCGACAGAAGAAGAGTTGTGGCTACTTTTTTTGGATTGACCCCGAATTGCCAAACCAGTGGTACAAAGACACCATGTTTAATATGTACCACCATGGGGGAGAAATTGAAGA...

Protein

Download Protein FASTA

143 aa · TkA04G114780|TK1151|PROTEIN

MASSVSSVSGGGRSRRQGIRSRCGCGDLVGSWTCWKSTHPGRRFVGCPNFRQKKSCGYFFWIDPELPNQWYKDTMFNMYHHGGEIEEVHYPHVYQVEPPHVYLEPPHVYQEPVVEAKHGEDEARKWKFGFFVCLVVILWLIVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G114780`
TK1151 ID	TkA04G114780
OH-1004 ID	LXL04_006734
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 41.520 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G114780`
Location	Chr04:29818388-29818890 (+)
Description	Similar to SNAT2: Serotonin N-acetyltransferase 2, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006734` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006474 N-terminal protein amino acid acetylation Biological Process GO:0018394 peptidyl-lysine acetylation Biological Process GO:0030187 melatonin biosynthetic process Biological Process GO:2000028 regulation of photoperiodism, flowering Biological Process GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0004059 aralkylamine N-acetyltransferase activity Molecular Function GO:0008080 N-acetyltransferase activity Molecular Function GO:0046982 protein heterodimerization activity Molecular Function GO:0061733 protein-lysine-acetyltransferase activity Molecular Function
KEGG gene cross-reference	ath:AT1G26220 dosa:Os08g0102000 syn:sll0286 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.482

Rank 1 · TkA04G114780 · TK1151

Endoplasmic reticulum0.260

Rank 2 · TkA04G114780 · TK1151

Cytoplasm0.208

Rank 3 · TkA04G114780 · TK1151

Mitochondrion0.090

Rank 4 · TkA04G114780 · TK1151

Cell membrane0.079

Rank 5 · TkA04G114780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30834DUF874821-53 aa

PF06839Zn_ribbon_GRF23-63 aa

PF06839Zn_ribbon_GRF116-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G114780	`PF30834`	DUF8748	21	53	0.57	11.3
TkA04G114780	`PF06839`	Zn_ribbon_GRF	23	63	0.00027	21.7
TkA04G114780	`PF06839`	Zn_ribbon_GRF	116	133	0.00027	21.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card