RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G114670
Reference: TK1151 Chr: Chr04 Coordinates: 29772318-29777391 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2362 bp · TkA04G114670|TK1151|cDNA

CACTGATGAGTCTTGTCCGTGTATAGCGATTTTAAATCTGGTGTTGGATTACACCCGATGAGTCGCAATCTCACCTGCCATCCGACGGCTCATGTTTATCCGGATCCTCTCACCATACAAAACCAAATGCCCCCACCAAAATTATTTTTTTTCTTATCTCACCACACCTCCCACGGTGGCAATGGCCGAAACCCCAACACCGTTGCAGCCGTCGTCTCCGCCGCCGCAGGCTGCCTCCGATAATCCCGATCCCGTACAAT...

CDS

Download CDS FASTA

1212 bp · TkA04G114670|TK1151|CDS

ATGTTTATCCGGATCCTCTCACCATACAAAACCAAATGCCCCCACCAAAATTATTTTTTTTCTTATCTCACCACACCTCCCACGGTGGCAATGGCCGAAACCCCAACACCGTTGCAGCCGTCGTCTCCGCCGCCGCAGGCTGCCTCCGATAATCCCGATCCCGTACAATACTGGTGTTACCAGTGCGATAAACGAGTCCCCGTCGAAACCCGACCCGATGATCCGGATATCATCTGTTTTGAGTGTAAGAACGGATTTGT...

Protein

Download Protein FASTA

403 aa · TkA04G114670|TK1151|PROTEIN

MFIRILSPYKTKCPHQNYFFSYLTTPPTVAMAETPTPLQPSSPPPQAASDNPDPVQYWCYQCDKRVPVETRPDDPDIICFECKNGFVESISVPSHAREVSDEDTPAFGNEFLQVLRLIAQSAREEDEPPPPPPAGHPVGDNDYLRIELDGWDNRILDVNEVEEEEDPQVDEGRARFYYDDDDEEDDDEQEEEGEEIENRNQEEEEVDEDIVRRERRDVLRLRLRDFASRASNRRNRILDWAEILMGLEDQSIEFRLQVPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G114670
TK1151 IDTkA04G114670
OH-1004 IDLXL04_035701
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)98.100
Protein coverage (%)TK1151 91.315 / OH-1004 34.659
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G114670
LocationChr04:29772318-29777391 (-)
DescriptionSimilar to BIR2: Inactive LRR receptor-like serine/threonine-protein kinase BIR2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g64920 E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.
The RING finger motif of photomorphogenic repressor COP1 specifically interacts with the RING-H2 motif of a novel Arabidopsis protein.1999 · DOI: 10.1074/jbc.274.39.27674
Biochemical evidence for ubiquitin ligase activity of the Arabidopsis COP1 interacting protein 8 (CIP8).2002 · DOI: 10.1046/j.1365-313x.2002.01298.x
At3g19950 E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. No verified direct reference in this release
At5g59550 E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid-dependent drought stress responses.
Suppression of Arabidopsis RING-DUF1117 E3 ubiquitin ligases, AtRDUF1 and AtRDUF2, reduces tolerance to ABA-mediated drought stress.2012 · DOI: 10.1016/j.bbrc.2012.02.131
At2g40830 Probable E3 ubiquitin-protein ligase that may possess E3 ubiquitin ligase activity in vitro. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035701 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0006952 defense response Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0031348 negative regulation of defense response Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0045088 regulation of innate immune response Biological Process
GO:1900150 regulation of defense response to fungus Biological Process
GO:1900425 negative regulation of defense response to bacterium Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G27190
ath:AT1G69990
ath:AT3G28450
ath:AT5G48380
ath:AT5G64920
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.600
Rank 1 · TkA04G114670 · TK1151
Nucleus0.441
Rank 2 · TkA04G114670 · TK1151
Cell membrane0.082
Rank 3 · TkA04G114670 · TK1151
Endoplasmic reticulum0.079
Rank 4 · TkA04G114670 · TK1151
Lysosome / Vacuole0.058
Rank 5 · TkA04G114670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21363TRAF3_RING6-16 aa
PF11789zf-Nse10-15 aa
PF29452FAR1_N12-26 aa
PF03604Zn_ribbon_RPAB454-82 aa
PF01155HypA54-88 aa
PF23412zf_RING_Vps855-62 aa
PF14369Zn_ribbon_1956-90 aa
PF23413zf_RING_Vps8_fungal56-64 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G114670PF21363TRAF3_RING6160.1612.5
TkA04G114670PF11789zf-Nse10150.1213.0
TkA04G114670PF29452FAR1_N12260.0813.7
TkA04G114670PF03604Zn_ribbon_RPAB454820.939.6
TkA04G114670PF01155HypA54888.57.2
TkA04G114670PF23412zf_RING_Vps855621.39.7
TkA04G114670PF14369Zn_ribbon_1956901e-1145.5
TkA04G114670PF23413zf_RING_Vps8_fungal56645.07.2
TkA04G114670PF13920zf-C3HC4_358670.005317.2
TkA04G114670PF27108PHD_Pygo58830.04414.6
TkA04G114670PF24042DUF7351591087.17.1
TkA04G114670PF23413zf_RING_Vps8_fungal73865.07.2
TkA04G114670PF23555zf-RING_Vps4176830.0003221.0
TkA04G114670PF23412zf_RING_Vps876821.39.7
TkA04G114670PF14447Prok-RING_4771020.3211.6
TkA04G114670PF23146Zf_IFT144_1st77831.49.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SPL2Arabidopsis thalianasp|Q9SPL2|CIP8_ARATH E3 ubiquitin-protein ligase CIP845.500%Swiss-ProtMedium
Q8LPN7Arabidopsis thalianasp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like51.800%Swiss-ProtLow
Q940T5Arabidopsis thalianasp|Q940T5|RDUF2_ARATH E3 ubiquitin-protein ligase RDUF246.500%Swiss-ProtLow
O22197Arabidopsis thalianasp|O22197|RHC1A_ARATH Probable E3 ubiquitin-protein ligase RHC1A45.300%Swiss-ProtLow

JBrowse

View in Genome Browser