TkA04G114380 | RubberDandelionOmics

Gene overview

TkA04G114380

Reference: TK1151 Chr: Chr04 Coordinates: 29686185-29690233 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1661 bp · TkA04G114380|TK1151|cDNA

AAAAAAAGAATTCGCAAATCATCGGATACAGAAGAACGCTGTTCTTGCTCCCTGCCGATTCTGCAAATCCTTCCTCCTGTTGCGAGAGAAAGGGGAGACATGACTGCTGCGGCATACGGTCAGCTTAATCTCGAAGAGTCGCCATCATGGGGTTCTCGAAGTGTAGACTGTTTCGAAAAACTTGAACAAATTGGCGAAGGAACATACGGTCAAGTATACATGGCCAGAGAATTAAAAACCGGCGAAATTGTTGCATTGAA...

CDS

Download CDS FASTA

1362 bp · TkA04G114380|TK1151|CDS

AAAAAAAGAATTCGCAAATCATCGGATACAGAAGAACGCTGTTCTTGCTCCCTGCCGATTCTGCAAATCCTTCCTCCTGTTGCGAGAGAAAGGGGAGACATGACTGCTGCGGCATACGGTCAGCTTAATCTCGAAGAGTCGCCATCATGGGGTTCTCGAAGTGTAGACTGTTTCGAAAAACTTGAACAAATTGGCGAAGGAACATACGGTCAAGTATACATGGCCAGAGAATTAAAAACCGGCGAAATTGTTGCATTGAA...

Protein

Download Protein FASTA

453 aa · TkA04G114380|TK1151|PROTEIN

KKRIRKSSDTEERCSCSLPILQILPPVARERGDMTAAAYGQLNLEESPSWGSRSVDCFEKLEQIGEGTYGQVYMARELKTGEIVALKKIRMDNEKEGFPITAIREIKILKKLQHENVIKLKEIVTSSGPEVDEHGKSGGHMYKGSIYMVFEYMDHDLTGLSDRPGLRFTIPQIKCYMKQLLTGLHYCHVNQVLHRDIKGSNLLIDNEGNLKLADFGLARSYSTDCKGNLTNRVITLWYRPPELLLGATRYGPSVDMWSVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G114380`
TK1151 ID	TkA04G114380
OH-1004 ID	LXL04_035707
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 95.364 / OH-1004 80.515 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G114380

Location Chr04:29686185-29690233 (-)

Description Similar to CDKC-1: Cyclin-dependent kinase C-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10270`	Cyclin-dependent kinase C-1.	No verified direct reference in this release
`At5g64960`	Cyclin-dependent kinase C-2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0389700`	Cyclin-dependent kinase C-1.	No verified direct reference in this release
`Os01g0958000`	Cyclin-dependent kinase C-2.	No verified direct reference in this release
`Os08g0453800`	Cyclin-dependent kinase C-3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035707 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009615 response to virus Biological Process

GO:0009908 flower development Biological Process

GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process

GO:0048440 carpel development Biological Process

GO:0050792 regulation of viral process Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0004693 cyclin-dependent protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G10270

ath:AT5G64960

dosa:Os01g0958000

dosa:Os05g0389700

osa:9268645

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.804

Rank 1 · TkA04G114380 · TK1151

Cytoplasm0.351

Rank 2 · TkA04G114380 · TK1151

Cell membrane0.046

Rank 3 · TkA04G114380 · TK1151

Mitochondrion0.031

Rank 4 · TkA04G114380 · TK1151

Endoplasmic reticulum0.023

Rank 5 · TkA04G114380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC156-91 aa

PF00069Pkinase58-357 aa

PF07714PK_Tyr_Ser-Thr60-278 aa

PF12330Haspin_kinase64-112 aa

PF14531Kinase-like65-97 aa

PF07387Seadorna_VP7184-215 aa

PF14531Kinase-like186-252 aa

PF03109ABC1188-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G114380	`PF03109`	ABC1	56	91	3.7e-07	30.3
TkA04G114380	`PF00069`	Pkinase	58	357	1.2e-72	245.2
TkA04G114380	`PF07714`	PK_Tyr_Ser-Thr	60	278	1.2e-28	100.8
TkA04G114380	`PF12330`	Haspin_kinase	64	112	0.078	12.7
TkA04G114380	`PF14531`	Kinase-like	65	97	0.037	14.0
TkA04G114380	`PF07387`	Seadorna_VP7	184	215	0.26	11.0
TkA04G114380	`PF14531`	Kinase-like	186	252	0.037	14.0
TkA04G114380	`PF03109`	ABC1	188	235	3.7e-07	30.3
TkA04G114380	`PF12330`	Haspin_kinase	194	221	0.078	12.7
TkA04G114380	`PF03109`	ABC1	314	330	3.7e-07	30.3
TkA04G114380	`PF00069`	Pkinase	381	402	1.2e-72	245.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFT8`	Arabidopsis thaliana	sp\|Q9LFT8\|CDKC1_ARATH Cyclin-dependent kinase C-1	80.400%	Swiss-Prot	High
`Q8W4P1`	Arabidopsis thaliana	sp\|Q8W4P1\|CDKC2_ARATH Cyclin-dependent kinase C-2	81.100%	Swiss-Prot	High
`Q6I5Y0`	Oryza sativa subsp. japonica	sp\|Q6I5Y0\|CDKC1_ORYSJ Cyclin-dependent kinase C-1	83.600%	Swiss-Prot	High
`Q5JK68`	Oryza sativa subsp. japonica	sp\|Q5JK68\|CDKC2_ORYSJ Cyclin-dependent kinase C-2	81.000%	Swiss-Prot	High
`Q6ZAG3`	Oryza sativa subsp. japonica	sp\|Q6ZAG3\|CDKC3_ORYSJ Cyclin-dependent kinase C-3	58.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card