LXL04_035707 | RubberDandelionOmics

Gene overview

LXL04_035707

Reference: OH-1004 Chr: Chr08 Coordinates: 27501110-27504906 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1635 bp · LXL04_035707|LXL04_035707|OH1004|cDNA

ATGTTGCTAGGtgatttttccaaaaaaagAATTCGCAAATCATCGGATACAGAAGAACGCTGTTCTTGCTCCCTGCCGATTCTGCAAATCCTTCCTCCTGTTGCGAGAGAAAGGGGAGACATGACTGCTGCGGCATACGGTCAGCTTAATCTCGAAGAGTCGCCATCATGGGGTTCTCGAAGTGTAGACTGTTTCGAAAAACTTGAACAAATTGGCGAAGGAACATACGGTCAAGTATACATGGCCAGAGAATTAAAAAC...

CDS

Download CDS FASTA

1635 bp · LXL04_035707|LXL04_035707|OH1004|CDS

ATGTTGCTAGGTGATTTTTCCAAAAAAAGAATTCGCAAATCATCGGATACAGAAGAACGCTGTTCTTGCTCCCTGCCGATTCTGCAAATCCTTCCTCCTGTTGCGAGAGAAAGGGGAGACATGACTGCTGCGGCATACGGTCAGCTTAATCTCGAAGAGTCGCCATCATGGGGTTCTCGAAGTGTAGACTGTTTCGAAAAACTTGAACAAATTGGCGAAGGAACATACGGTCAAGTATACATGGCCAGAGAATTAAAAAC...

Protein

Download Protein FASTA

544 aa · LXL04_035707|LXL04_035707|OH1004|PROTEIN

MLLGDFSKKRIRKSSDTEERCSCSLPILQILPPVARERGDMTAAAYGQLNLEESPSWGSRSVDCFEKLEQIGEGTYGQVYMARELKTGEIVALKKIRMDNEKEGFPITAIREIKILKKLQHENVIKLKEIVTSSGPEVDEHGKSGGHMYKGSIYMVFEYMDHDLTGLSDRPGLRFTIPQIKCYMKQLLTGLHYCHVNQVLHRDIKGSNLLIDNEGNLKLADFGLARSYSTDCKGNLTNRVITLWYRPPELLLGATRYGPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035707`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035707

Location Chr08:27501110-27504906 (+)

Description Similar to CDKC-1: Cyclin-dependent kinase C-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10270`	Cyclin-dependent kinase C-1.	No verified direct reference in this release
`At5g64960`	Cyclin-dependent kinase C-2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0958000`	Cyclin-dependent kinase C-2.	No verified direct reference in this release
`Os05g0389700`	Cyclin-dependent kinase C-1.	No verified direct reference in this release
`Os08g0453800`	Cyclin-dependent kinase C-3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035707 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009615 response to virus Biological Process

GO:0009908 flower development Biological Process

GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process

GO:0048440 carpel development Biological Process

GO:0050792 regulation of viral process Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0004693 cyclin-dependent protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT5G10270

ath:AT5G64960

dosa:Os01g0958000

dosa:Os05g0389700

osa:9268645

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.788

Rank 1 · LXL04_035707 · OH-1004

Cytoplasm0.364

Rank 2 · LXL04_035707 · OH-1004

Cell membrane0.041

Rank 3 · LXL04_035707 · OH-1004

Mitochondrion0.027

Rank 4 · LXL04_035707 · OH-1004

Endoplasmic reticulum0.026

Rank 5 · LXL04_035707 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase65-364 aa

PF07714.24PK_Tyr_Ser-Thr67-287 aa

PF03109.23ABC1195-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035707	`PF00069.32`	Pkinase	65	364	2e-72	244.5
LXL04_035707	`PF07714.24`	PK_Tyr_Ser-Thr	67	287	2.1e-28	100.0
LXL04_035707	`PF03109.23`	ABC1	195	242	6.6e-07	29.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFT8`	Arabidopsis thaliana	Cyclin-dependent kinase C-1	72.361%	Swiss-Prot	strong database homology
`Q8W4P1`	Arabidopsis thaliana	Cyclin-dependent kinase C-2	72.381%	Swiss-Prot	strong database homology
`Q5JK68`	Oryza sativa subsp. japonica	Cyclin-dependent kinase C-2	79.043%	Swiss-Prot	strong database homology
`Q6I5Y0`	Oryza sativa subsp. japonica	Cyclin-dependent kinase C-1	78.132%	Swiss-Prot	strong database homology
`Q6ZAG3`	Oryza sativa subsp. japonica	Cyclin-dependent kinase C-3	58.696%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card