Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4862 bp · TkA04G114330|TK1151|cDNA
ACAATTGCCGGCCGGCAGTTTTGGAAGCCGGCCTCTCTCTAGAATACGTTTGATCATGAGTGTGAATCAAGCATTGGATTGGTCAATATCCAGTTTGTCAGTATAATTGTACCTGTCATCTTACTTTTTCATTGTTGAAATTTTAGTTTTTTACTCTTCTGCTTCAAGTTTATTGGATCATGACCGAGTACTGAGTGGTTACAGCAATCATTACTTCGTCACTGTTTTCAATGGACCAAAATGAAGTAGCGAGATCCTTA...
3414 bp · TkA04G114330|TK1151|CDS
ATGTTTCTAATACAGGAGGGAATACCAGAGGAAAACGACGAATCTGACTATGAACCAGATGAAGAGAGAAATCAAAGCATACAATCACTTCCAAGTGTTGAAACGAGCAATAATTACAGAACTGGACCTAATGAACACACATTGAAGGAAAAGAATCGACCTTTTTCTCCTCAGATGTTCTCCCCTGTAATCTCAAGTAAATCATCCCCAAAAGTTTCATCTCCAAAACAAGATGGAAACAATAAGGTCACGTCTACATC...
Protein
Download Protein FASTA1137 aa · TkA04G114330|TK1151|PROTEIN
MFLIQEGIPEENDESDYEPDEERNQSIQSLPSVETSNNYRTGPNEHTLKEKNRPFSPQMFSPVISSKSSPKVSSPKQDGNNKVTSTSTLRANRSMDYRVATSLPTSPLVHHDLSISSPDSDNESREHKKSVRTRVGHGRSSSHANLKSQTSDKSFHGEYDSGSPNFGSPQSSTHSRPPKDFVCPITSHLFTDPVTLETGQTYERKAIEEWVKRGNTTCPITRQPLSANSLPKTNYVLKRLITSWKEQHPDLAQELSYPAT...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G114330 |
|---|---|
| TK1151 ID | TkA04G114330 |
| OH-1004 ID | LXL04_035709 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 99.736 / OH-1004 77.778Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G114330 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:29664869-29670707 (-) | |||||||||
| Description | Similar to CERBERUS: Putative E3 ubiquitin-protein ligase LIN-1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0007166 cell surface receptor signaling pathway Biological Process GO:0009877 nodulation Biological Process GO:0009908 flower development Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031348 negative regulation of defense response Biological Process GO:0043069 negative regulation of programmed cell death Biological Process GO:0048586 regulation of long-day photoperiodism, flowering Biological Process GO:2000028 regulation of photoperiodism, flowering Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component | |||||||||
| KEGG gene cross-reference | dosa:Os12g0570000 mtr:11418360 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04564U-box178-248 aaPF11789zf-Nse180-220 aaPF13445zf-RING_UBOX183-219 aaPF15227zf-C3HC4_4183-219 aaPF23654ARM_LIN_2nd317-475 aaPF23628ARM_LIN_C371-420 aaPF23628ARM_LIN_C477-833 aaPF23654ARM_LIN_2nd514-531 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G114330 | PF04564 | U-box | 178 | 248 | 3.2e-17 | 63.1 |
| TkA04G114330 | PF11789 | zf-Nse | 180 | 220 | 8.9e-05 | 23.0 |
| TkA04G114330 | PF13445 | zf-RING_UBOX | 183 | 219 | 0.01 | 16.5 |
| TkA04G114330 | PF15227 | zf-C3HC4_4 | 183 | 219 | 0.02 | 15.7 |
| TkA04G114330 | PF23654 | ARM_LIN_2nd | 317 | 475 | 3.3e-54 | 183.6 |
| TkA04G114330 | PF23628 | ARM_LIN_C | 371 | 420 | 6.3e-111 | 371.6 |
| TkA04G114330 | PF23628 | ARM_LIN_C | 477 | 833 | 6.3e-111 | 371.6 |
| TkA04G114330 | PF23654 | ARM_LIN_2nd | 514 | 531 | 3.3e-54 | 183.6 |
| TkA04G114330 | PF23775 | Beta-prop_RIG_2nd | 695 | 722 | 0.00033 | 20.9 |
| TkA04G114330 | PF24782 | WD40_MABP1-WDR62_2nd | 709 | 752 | 0.0079 | 15.9 |
| TkA04G114330 | PF23654 | ARM_LIN_2nd | 767 | 797 | 3.3e-54 | 183.6 |
| TkA04G114330 | PF25048 | Beta-prop_TEP1_C | 862 | 890 | 0.0001 | 22.9 |
| TkA04G114330 | PF23798 | Beta-prop_SPT8 | 862 | 890 | 0.046 | 13.3 |
| TkA04G114330 | PF25047 | Beta-prop_TEP1_2nd | 863 | 889 | 5.2e-07 | 29.8 |
| TkA04G114330 | PF23754 | Beta-prop_IP5PC_F | 865 | 930 | 0.019 | 14.6 |
| TkA04G114330 | PF00400 | WD40 | 868 | 886 | 1.3e-16 | 61.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.