TkA04G113620 | RubberDandelionOmics

Gene overview

TkA04G113620

Reference: TK1151 Chr: Chr04 Coordinates: 29491199-29492578 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

933 bp · TkA04G113620|TK1151|cDNA

ATGGCGGATGTTGAACGACAATGGCGAGAGACTATCGATCCTCAAAATCTTACTCTTGGTAAAGTTATCGGTAGTGGAAGTTTCGGTGTTGTTTATAAAGCCTCCTACCAAGGCCAAACTGTAGCAGCGAAAGTTCTTGATTTTAAAATCAAAATTCCGATGGGGATCATGAAGGAAGCTTTCATAGAAGAAGTTCAAGTGTGGAAAAATCTTGATCATCCGAACGTAACTAAGATGATCGGAGCAACCGTTTCCATGAT...

CDS

Download CDS FASTA

933 bp · TkA04G113620|TK1151|CDS

ATGGCGGATGTTGAACGACAATGGCGAGAGACTATCGATCCTCAAAATCTTACTCTTGGTAAAGTTATCGGTAGTGGAAGTTTCGGTGTTGTTTATAAAGCCTCCTACCAAGGCCAAACTGTAGCAGCGAAAGTTCTTGATTTTAAAATCAAAATTCCGATGGGGATCATGAAGGAAGCTTTCATAGAAGAAGTTCAAGTGTGGAAAAATCTTGATCATCCGAACGTAACTAAGATGATCGGAGCAACCGTTTCCATGAT...

Protein

Download Protein FASTA

310 aa · TkA04G113620|TK1151|PROTEIN

MADVERQWRETIDPQNLTLGKVIGSGSFGVVYKASYQGQTVAAKVLDFKIKIPMGIMKEAFIEEVQVWKNLDHPNVTKMIGATVSMITPNSRHKIKKPKPENNFCVISEYVNGGTLGSYLWKHRSKRLPYKTVIGFAIDIAKGLSYLHSQKVIHCDVKPENMLMDEKKTIKIADFGVSEIEPLERFIISGEKGTRGYMAPELVSRQPHGRKCDVYSFGICLWEIYCCDVAYTFLLDNLTPNIYKEMRPSIPMHCPRPLAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G113620`
TK1151 ID	TkA04G113620
OH-1004 ID	LXL04_035723
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 90.379 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G113620

Location Chr04:29491199-29492578 (+)

Description Similar to STY46: Serine/threonine-protein kinase STY46

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01490`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues.	Raf-like kinases CBC1 and CBC2 negatively regulate stomatal opening by negatively regulating plasma membrane H + -ATPase phosphorylation in Arabidopsis.2020 · DOI: 10.1039/c9pp00329k
`At5g50000`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues.	Raf-like kinases CBC1 and CBC2 negatively regulate stomatal opening by negatively regulating plasma membrane H + -ATPase phosphorylation in Arabidopsis.2020 · DOI: 10.1039/c9pp00329k
`At2g24360`	Serine/threonine protein kinase that phosphorylates proteins on serine, threonine and tyrosine residues.	Genome-wide analysis and experimentation of plant serine/ threonine/tyrosine-specific protein kinases.2006 · DOI: 10.1007/s11103-005-4109-7
`At4g38470`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At4g35780`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035723 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001659 temperature homeostasis Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009637 response to blue light Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010114 response to red light Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1902456 regulation of stomatal opening Biological Process

KEGG gene cross-reference

ath:AT2G24360

ath:AT4G35780

ath:AT4G38470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.580

Rank 1 · TkA04G113620 · TK1151

Cell membrane0.351

Rank 2 · TkA04G113620 · TK1151

Nucleus0.330

Rank 3 · TkA04G113620 · TK1151

Golgi apparatus0.051

Rank 4 · TkA04G113620 · TK1151

Mitochondrion0.048

Rank 5 · TkA04G113620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12330Haspin_kinase11-181 aa

PF14531Kinase-like14-45 aa

PF07714PK_Tyr_Ser-Thr17-283 aa

PF00069Pkinase19-280 aa

PF03109ABC122-51 aa

PF17667Pkinase_fungal138-217 aa

PF14531Kinase-like141-247 aa

PF07387Seadorna_VP7142-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G113620	`PF12330`	Haspin_kinase	11	181	0.076	12.7
TkA04G113620	`PF14531`	Kinase-like	14	45	0.0032	17.5
TkA04G113620	`PF07714`	PK_Tyr_Ser-Thr	17	283	1.2e-53	182.8
TkA04G113620	`PF00069`	Pkinase	19	280	1.2e-50	173.0
TkA04G113620	`PF03109`	ABC1	22	51	3.9e-06	26.9
TkA04G113620	`PF17667`	Pkinase_fungal	138	217	0.15	11.5
TkA04G113620	`PF14531`	Kinase-like	141	247	0.0032	17.5
TkA04G113620	`PF07387`	Seadorna_VP7	142	175	0.1	12.4
TkA04G113620	`PF03109`	ABC1	144	178	3.9e-06	26.9
TkA04G113620	`PF10140`	YukC	148	183	0.24	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSA4`	Arabidopsis thaliana	sp\|Q9SSA4\|CBC1_ARATH Serine/threonine-protein kinase 54	46.700%	Swiss-Prot	Medium
`Q9FGB1`	Arabidopsis thaliana	sp\|Q9FGB1\|CBC2_ARATH Serine/threonine-protein kinase 52	46.300%	Swiss-Prot	Medium
`Q9ZQ31`	Arabidopsis thaliana	sp\|Q9ZQ31\|STY13_ARATH Serine/threonine-protein kinase STY13	34.700%	Swiss-Prot	Medium
`F4JTP5`	Arabidopsis thaliana	sp\|F4JTP5\|STY46_ARATH Serine/threonine-protein kinase STY46	36.800%	Swiss-Prot	Medium
`Q8RWL6`	Arabidopsis thaliana	sp\|Q8RWL6\|STY17_ARATH Serine/threonine-protein kinase STY17	31.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card