LXL04_035723 | RubberDandelionOmics

Gene overview

LXL04_035723

Reference: OH-1004 Chr: Chr08 Coordinates: 27693546-27695024 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1032 bp · LXL04_035723|LXL04_035723|OH1004|cDNA

ATGGAGGCAGTCAAAGTAGTAGAAGATATGGAACTCACTCACAACAAGTTAACCAGGAGTCATGATCAACGACTGAATCTGCTGAAGTCTTATTGTATCATGGCGGATGTTGAACGACAATGGCGAGAGACTATCGATCCTCAAAATCTTACTCTTGGTAAAGTTATCGGTAGTGGAAGTTTCGGTGTTGTTTATAAAGCCTCCTACCAAGGCCAAACTGTAGCAGCGAAAGTTCTTGATTTTAAAATCAAAATTCCGAT...

CDS

Download CDS FASTA

1032 bp · LXL04_035723|LXL04_035723|OH1004|CDS

ATGGAGGCAGTCAAAGTAGTAGAAGATATGGAACTCACTCACAACAAGTTAACCAGGAGTCATGATCAACGACTGAATCTGCTGAAGTCTTATTGTATCATGGCGGATGTTGAACGACAATGGCGAGAGACTATCGATCCTCAAAATCTTACTCTTGGTAAAGTTATCGGTAGTGGAAGTTTCGGTGTTGTTTATAAAGCCTCCTACCAAGGCCAAACTGTAGCAGCGAAAGTTCTTGATTTTAAAATCAAAATTCCGAT...

Protein

Download Protein FASTA

343 aa · LXL04_035723|LXL04_035723|OH1004|PROTEIN

MEAVKVVEDMELTHNKLTRSHDQRLNLLKSYCIMADVERQWRETIDPQNLTLGKVIGSGSFGVVYKASYQGQTVAAKVLDFKIKIPMGIMKEAFIEEVQVWKNLDHPNVTKMIGATVSMITPNSRHKIKKPKPENNFCVISEYVNGGTLGSYLWKHRSKKLPYKTVIGFAIDIAKGLSYLHSQKVIHCDVKPENMLMDEKKTIKIADFGVSEIEPLERFIISGEKGTRGYMAPELVSRQPHGRKCDVYSFGICLWEIYCC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035723`
TK1151 ID	TkA04G113620
OH-1004 ID	LXL04_035723
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 90.379 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035723

Location Chr08:27693546-27695024 (-)

Description Similar to STY46: Serine/threonine-protein kinase STY46

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01490`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues.	Raf-like kinases CBC1 and CBC2 negatively regulate stomatal opening by negatively regulating plasma membrane H + -ATPase phosphorylation in Arabidopsis.2020 · DOI: 10.1039/c9pp00329k
`At5g50000`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues.	Raf-like kinases CBC1 and CBC2 negatively regulate stomatal opening by negatively regulating plasma membrane H + -ATPase phosphorylation in Arabidopsis.2020 · DOI: 10.1039/c9pp00329k
`At4g38470`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At4g35780`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774
`At2g24360`	Serine/threonine protein kinase that phosphorylates proteins on serine, threonine and tyrosine residues.	Genome-wide analysis and experimentation of plant serine/ threonine/tyrosine-specific protein kinases.2006 · DOI: 10.1007/s11103-005-4109-7

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035723 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001659 temperature homeostasis Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009637 response to blue light Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010114 response to red light Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1902456 regulation of stomatal opening Biological Process

KEGG gene cross-reference

ath:AT2G24360

ath:AT4G35780

ath:AT4G38470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · LXL04_035723 · OH-1004

Cell membrane0.422

Rank 2 · LXL04_035723 · OH-1004

Nucleus0.280

Rank 3 · LXL04_035723 · OH-1004

Golgi apparatus0.055

Rank 4 · LXL04_035723 · OH-1004

Mitochondrion0.044

Rank 5 · LXL04_035723 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr50-316 aa

PF00069.32Pkinase52-313 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035723	`PF07714.24`	PK_Tyr_Ser-Thr	50	316	1.1e-53	182.9
LXL04_035723	`PF00069.32`	Pkinase	52	313	1.4e-50	172.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSA4`	Arabidopsis thaliana	Serine/threonine-protein kinase 54	47.040%	Swiss-Prot	moderate database homology
`Q9FGB1`	Arabidopsis thaliana	Serine/threonine-protein kinase 52	46.580%	Swiss-Prot	moderate database homology
`F4JTP5`	Arabidopsis thaliana	Serine/threonine-protein kinase STY46	37.050%	Swiss-Prot	moderate database homology
`Q8RWL6`	Arabidopsis thaliana	Serine/threonine-protein kinase STY17	31.683%	Swiss-Prot	moderate database homology
`Q9ZQ31`	Arabidopsis thaliana	Serine/threonine-protein kinase STY13	34.520%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card