RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G112920
Reference: TK1151 Chr: Chr04 Coordinates: 29305568-29311320 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3286 bp · TkA04G112920|TK1151|cDNA

TAGGACTCTTAACCCGTTTGCTTGAATATATTAGGCTAAATTAACATTTTCATGAATAACCTAACTCATTGTCACCCTCTGTTTTATATATCAATTTTTAAAAAGAGCTCCAGTCTTTTATATTCAGTCAAATGGAAGTAGAATATTCGGTGCTGTATATTTTAAAATACATCAATCATCTCGACCTTCAATTTACGACTTCCTTTTCGTGTATGCGTACTCTACCTCTGCAAATGCTCTAATTTGCTGATTAAATCTCT...

CDS

Download CDS FASTA

2154 bp · TkA04G112920|TK1151|CDS

ATGAGTATCATTGAAGAGAAGACTGGGGGTTACAGTTTACTTGGGGATATGAAATTGGTGAAGGAAATGCAGGATCATTGTGGGAAAAAGAAGTCAATAAATTCAGAGCTATGGCATGCATGTGCGGGGCCATTGGTAAATTTACCACAGCTTGGAAGCCTTGTTTATTACTTCCCGCAAGGACACAGTGAACAGGTGGCGGCCTCGACAAATCGAACTGCAACAACACAAGTTCCAAATTACCCGAATCTTCCTTCACA...

Protein

Download Protein FASTA

717 aa · TkA04G112920|TK1151|PROTEIN

MSIIEEKTGGYSLLGDMKLVKEMQDHCGKKKSINSELWHACAGPLVNLPQLGSLVYYFPQGHSEQVAASTNRTATTQVPNYPNLPSQLLCHVQNTTLHADKDTDEIYAQISLQPMNSEKDVFPIPDFGMKPSKHPTEFFCKTLTPSDTSTHGGFSVPRRAAEKLFPQLDFAMQPPTQELVVRDLHDNTWTFRHIYRGQPKRHLLTTGWSMFVSAKRLKAGDAVLFVRDERSQLLLGVRRANRQQTASSSSVLSADSMHIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G112920
TK1151 IDTkA04G112920
OH-1004 IDLXL04_035732
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G112920
LocationChr04:29305568-29311320 (+)
DescriptionSimilar to ARF5: Auxin response factor 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g19850 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Overlapping and non-redundant functions of the Arabidopsis auxin response factors MONOPTEROS and NONPHOTOTROPIC HYPOCOTYL 4.2004 · DOI: 10.1242/dev.00925
AMP1 and MP antagonistically regulate embryo and meristem development in Arabidopsis.2007 · DOI: 10.1242/dev.006759

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: Q01K26 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
Os04g0664400 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
UniProt: Q258Y5 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
Os04g0671900 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035732 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0009908 flower development Biological Process
GO:0009942 longitudinal axis specification Biological Process
GO:0010051 xylem and phloem pattern formation Biological Process
GO:0010305 leaf vascular tissue pattern formation Biological Process
GO:0048364 root development Biological Process
GO:0048507 meristem development Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT1G19850
dosa:Os04g0664400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952
Rank 1 · TkA04G112920 · TK1151
Cytoplasm0.104
Rank 2 · TkA04G112920 · TK1151
Cell membrane0.030
Rank 3 · TkA04G112920 · TK1151
Plastid0.017
Rank 4 · TkA04G112920 · TK1151
Endoplasmic reticulum0.017
Rank 5 · TkA04G112920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25313BRWD_AD48-96 aa
PF13580SIS_251-122 aa
PF02362B3139-240 aa
PF02309AUX_IAA208-218 aa
PF25313BRWD_AD271-371 aa
PF06507ARF_AD288-370 aa
PF02309AUX_IAA606-694 aa
PF00564PB1618-673 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G112920PF25313BRWD_AD48969.3e-0936.2
TkA04G112920PF13580SIS_2511220.07813.7
TkA04G112920PF02362B31392401e-2383.9
TkA04G112920PF02309AUX_IAA2082183e-1144.2
TkA04G112920PF25313BRWD_AD2713719.3e-0936.2
TkA04G112920PF06507ARF_AD2883704.1e-29101.0
TkA04G112920PF02309AUX_IAA6066943e-1144.2
TkA04G112920PF00564PB16186730.2412.1
TkA04G112920PF06507ARF_AD6536654.1e-29101.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P93024Arabidopsis thalianasp|P93024|ARFE_ARATH Auxin response factor 555.000%Swiss-ProtHigh
Q01K26Oryza sativa subsp. indicasp|Q01K26|ARFK_ORYSI Auxin response factor 1143.800%Swiss-ProtMedium
Q8S983Oryza sativa subsp. japonicasp|Q8S983|ARFK_ORYSJ Auxin response factor 1143.800%Swiss-ProtMedium
Q258Y5Oryza sativa subsp. indicasp|Q258Y5|ARFL_ORYSI Auxin response factor 1241.900%Swiss-ProtMedium
Q0J951Oryza sativa subsp. japonicasp|Q0J951|ARFL_ORYSJ Auxin response factor 1241.800%Swiss-ProtMedium

JBrowse

View in Genome Browser