TkA04G109490 | RubberDandelionOmics

Gene overview

TkA04G109490

Reference: TK1151 Chr: Chr04 Coordinates: 28461384-28464706 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2190 bp · TkA04G109490|TK1151|cDNA

GCGCATTTTAGAAAGTCATGATTCTTGGTCCTGCATAAAATTTCAGTTTGTCCTAAATTTGTTGAGGAACCCTCCCTACTTCTCTCACTCCAATATCATAAACCCTAATTCAATACATCAGGCGAAAGAAGATAAATCATGGGTAGGTTTCGATTTGATTTGCTCCTGTTACTACTTGCCGTACATTGGGGTCCTGCGCTTTCCGATCTGGTCATCTCCAAGCTTGATCTGCAGATTGATCTGACTTCACAGATTGTACG...

CDS

Download CDS FASTA

1839 bp · TkA04G109490|TK1151|CDS

ATGGGTAGGTTTCGATTTGATTTGCTCCTGTTACTACTTGCCGTACATTGGGGTCCTGCGCTTTCCGATCTGGTCATCTCCAAGCTTGATCTGCAGATTGATCTGACTTCACAGATTGTACGAATGACTATGTCCTTCAAGGTGGAAAACACTGGTCCTGATCCCGTTTCCAAGGTATCATTAACCTTTCCAGAACACCAAGCAAATAATCTAGCACTTATAGTAGCAGTCAACACCCAAGGGAAAGGGAAAACGAAAGG...

Protein

Download Protein FASTA

612 aa · TkA04G109490|TK1151|PROTEIN

MGRFRFDLLLLLLAVHWGPALSDLVISKLDLQIDLTSQIVRMTMSFKVENTGPDPVSKVSLTFPEHQANNLALIVAVNTQGKGKTKGPTTNLPITISQPDNNSPPSLIWYAASLPKDLVKGESLTIDVLAVFTHTLRPFPEKITQSESQLFLFQESAHFPSPYKVKSQSMTVKLPTENAESYTKLENTKFANSEIKYGPYENLPPFSYSPVIIHFPSNKPFAVAQELVREIEISHWGNVQITEHYSIIHGGAQSTGEFSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G109490`
TK1151 ID	TkA04G109490
OH-1004 ID	LXL04_035776
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G109490

Location Chr04:28461384-28464706 (-)

Description Similar to OST1A: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76400`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release
`At2g01720`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0301500`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release
`Os04g0693000`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035776 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005791 rough endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008250 oligosaccharyltransferase complex Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0160226 oligosaccharyltransferase complex A Cellular Component

KEGG gene cross-reference

ath:AT1G76400

ath:AT2G01720

cfa:476516

dosa:Os05g0301500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.803

Rank 1 · TkA04G109490 · TK1151

Cytoplasm0.131

Rank 2 · TkA04G109490 · TK1151

Nucleus0.094

Rank 3 · TkA04G109490 · TK1151

Golgi apparatus0.085

Rank 4 · TkA04G109490 · TK1151

Cell membrane0.063

Rank 5 · TkA04G109490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04597Ribophorin_I26-452 aa

PF27661DRC10_N480-557 aa

PF24886DUF7740513-551 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G109490	`PF04597`	Ribophorin_I	26	452	7e-143	477.6
TkA04G109490	`PF27661`	DRC10_N	480	557	0.021	15.7
TkA04G109490	`PF24886`	DUF7740	513	551	0.048	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFX3`	Arabidopsis thaliana	sp\|Q9SFX3\|OST1A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A	63.900%	Swiss-Prot	High
`Q9ZUA0`	Arabidopsis thaliana	sp\|Q9ZUA0\|OST1B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B	50.000%	Swiss-Prot	High
`Q0DJC5`	Oryza sativa subsp. japonica	sp\|Q0DJC5\|OST1A_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1A	62.400%	Swiss-Prot	High
`B9FDT1`	Oryza sativa subsp. japonica	sp\|B9FDT1\|OST1B_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1B	49.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card