RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G109430
Reference: TK1151 Chr: Chr04 Coordinates: 28433938-28438690 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3468 bp · TkA04G109430|TK1151|cDNA

CTAAAAGGGCTAAAACCCTGTATAAAGGGTTTTCAAAGATTCTATGCTTTCAATCATAGTACCAATTTTCAGAAGCTTAAAGTTTTGGATTTTACCCTGAGCTGATTTGAAATTTCTAGGGTTTATCTGATATGGTGGAGCCTGCTCGGTGTTCATAATTTCATTCCGGTGTAAAGTGTGAAACCGGAAATACTTTCTCTCTCTACATATAAATTAACCGACATTTCCGGCGGCAGATCTAAACACTGACGGTGGTGGAG...

CDS

Download CDS FASTA

2115 bp · TkA04G109430|TK1151|CDS

ATGTCCAGGCCACTTCACAGAGGCGTATTAGGTGGAGGAAGACTCTCAGGAAACATTCAAGACTACTTACAAGACTCTCAAATGAAAGTTAAAACCGATAAAGAAGATCTAGACAAAATTACAAAAACACCCCCCAATGATCCTCATCACGTATCCCTATCTTTAAGAAACCCATTCCAATTCCTCTTCTCAGATACCCCTGCATCCAAACAAGACTCCATGGAAAACGGAGCTCTTGTATCCGATCCAATCACCCCCTC...

Protein

Download Protein FASTA

704 aa · TkA04G109430|TK1151|PROTEIN

MSRPLHRGVLGGGRLSGNIQDYLQDSQMKVKTDKEDLDKITKTPPNDPHHVSLSLRNPFQFLFSDTPASKQDSMENGALVSDPITPSSLRNRHMLTLLFLKFTLIIIVILGLTMSFLWTISLTTVSKGQMIRGYRRLQEQLVSDLWDIGELSLGTSKFKEADFCPLDSENSVPCYNITQNLELGFTEGKEYDRHCGPMSKQNCLIPAPIKYKIPHRWPTGRDVIWIDNVKITAQEVLSSGSLTKRMMMLDEDQISFSFAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G109430
TK1151 IDTkA04G109430
OH-1004 IDLXL04_030121
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)75.600
Protein coverage (%)TK1151 99.716 / OH-1004 94.708
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G109430
LocationChr04:28433938-28438690 (-)
DescriptionSimilar to QUA2: Probable pectin methyltransferase QUA2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g78240 May be involved in the synthesis of homogalacturonan.
Homogalacturonan synthesis in Arabidopsis thaliana requires a Golgi-localized protein with a putative methyltransferase domain.2007 · DOI: 10.1111/j.1365-313x.2007.03086.x
The TUMOROUS SHOOT DEVELOPMENT2 gene of Arabidopsis encoding a putative methyltransferase is required for cell adhesion and co-ordinated plant development.2007 · DOI: 10.1111/j.1365-313x.2007.03123.x
The OSU1/QUA2/TSD2-encoded putative methyltransferase is a critical modulator of carbon and nitrogen nutrient balance response in Arabidopsis.2008 · DOI: 10.1371/journal.pone.0001387
At1g13860 Probable methyltransferase PMT4. No verified direct reference in this release
At2g03480 Probable methyltransferase PMT5. No verified direct reference in this release
At5g14430 Probable methyltransferase PMT9. No verified direct reference in this release
At1g04430 Probable methyltransferase PMT8. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030121 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007155 cell adhesion Biological Process
GO:0009735 response to cytokinin Biological Process
GO:0010289 homogalacturonan biosynthetic process Biological Process
GO:0032259 methylation Biological Process
GO:0048364 root development Biological Process
GO:0048367 shoot system development Biological Process
GO:0000138 Golgi trans cisterna Cellular Component
GO:0000139 Golgi membrane Cellular Component
GO:0000325 plant-type vacuole Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
KEGG gene cross-reference
ath:AT1G04430
ath:AT1G13860
ath:AT1G78240
ath:AT2G03480
ath:AT3G23300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.721
Rank 1 · TkA04G109430 · TK1151
Endoplasmic reticulum0.080
Rank 2 · TkA04G109430 · TK1151
Cell membrane0.074
Rank 3 · TkA04G109430 · TK1151
Extracellular0.066
Rank 4 · TkA04G109430 · TK1151
Nucleus0.047
Rank 5 · TkA04G109430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03141Methyltransf_29172-694 aa
PF07021MetW286-358 aa
PF13489Methyltransf_23290-412 aa
PF05175MTS291-311 aa
PF13847Methyltransf_31293-407 aa
PF13649Methyltransf_25294-386 aa
PF08241Methyltransf_11295-389 aa
PF08242Methyltransf_12295-387 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G109430PF03141Methyltransf_291726948.4e-139464.1
TkA04G109430PF07021MetW2863580.02415.0
TkA04G109430PF13489Methyltransf_232904120.0004620.7
TkA04G109430PF05175MTS2913110.03114.6
TkA04G109430PF13847Methyltransf_312934073.3e-0627.7
TkA04G109430PF13649Methyltransf_252943868.3e-0730.3
TkA04G109430PF08241Methyltransf_112953894.5e-0834.3
TkA04G109430PF08242Methyltransf_122953870.114.1
TkA04G109430PF17166DUF51265465840.07813.7
TkA04G109430PF13649Methyltransf_256026518.3e-0730.3
TkA04G109430PF13847Methyltransf_316086713.3e-0627.7
TkA04G109430PF08242Methyltransf_126146250.114.1
TkA04G109430PF13489Methyltransf_236376600.0004620.7
TkA04G109430PF08241Methyltransf_116386554.5e-0834.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C9Q8Arabidopsis thalianasp|Q9C9Q8|PMTT_ARATH Probable pectin methyltransferase QUA259.600%Swiss-ProtHigh
Q8GYW9Arabidopsis thalianasp|Q8GYW9|PMT4_ARATH Probable methyltransferase PMT453.700%Swiss-ProtHigh
Q3EC77Arabidopsis thalianasp|Q3EC77|PMT5_ARATH Probable methyltransferase PMT556.000%Swiss-ProtHigh
Q8VZV7Arabidopsis thalianasp|Q8VZV7|PMT9_ARATH Probable methyltransferase PMT935.900%Swiss-ProtMedium
Q940J9Arabidopsis thalianasp|Q940J9|PMT8_ARATH Probable methyltransferase PMT837.000%Swiss-ProtMedium

JBrowse

View in Genome Browser