TkA04G106270 | RubberDandelionOmics

Gene overview

TkA04G106270

Reference: TK1151 Chr: Chr04 Coordinates: 27670675-27671942 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

901 bp · TkA04G106270|TK1151|cDNA

TTACCGTGTACCGCGATGCACATGACCATTCTCCCATCACTTTTGCTTCTCCTTCACCTTCAAATCTTCAATAGATCCTCATTTGCCACTGCTGCTCCCATCCCCTTCCTCTCAAAGCTTACGCTTCCTCTATCACACAGTTACACGCAAAACACACGACAATGGCGAAAGTGATGTTGATGCTGGCACTATGCGTGCTATTACCAGTGCTAATTAGCGCTTCCCGTCCGATGTCCCGTCCGTTCCGTTTACAAGGCAGA...

CDS

Download CDS FASTA

480 bp · TkA04G106270|TK1151|CDS

ATGGCGAAAGTGATGTTGATGCTGGCACTATGCGTGCTATTACCAGTGCTAATTAGCGCTTCCCGTCCGATGTCCCGTCCGTTCCGTTTACAAGGCAGAGTGTACTGCGATACCTGCCGTGCCGGTTTTGAGACCTCCGCCACCACTTACATTCCTCGTGCTAAGGTTAGGGTTGAATGCAAGGACAAGGCACAGAATCTTCTGTACAGCATTGAGGGAACAACTGATGCTACCGGAACATATCACATTCTTGTTCATGA...

Protein

Download Protein FASTA

159 aa · TkA04G106270|TK1151|PROTEIN

MAKVMLMLALCVLLPVLISASRPMSRPFRLQGRVYCDTCRAGFETSATTYIPRAKVRVECKDKAQNLLYSIEGTTDATGTYHILVHEDHGEETCDVVLVSSPMGNCKNADPGRDRARVVLTSYNGIASDTRFANAMGFMKDEIMSGCTTLLQSLMEEED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G106270`
TK1151 ID	TkA04G106270
OH-1004 ID	LXL04_031184
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G106270

Location Chr04:27670675-27671942 (+)

Description Similar to DFC: Protein DOWNSTREAM OF FLC

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10130`	Part of a three-gene cluster containing FLC, UFC and DFC, which is coordinately regulated in response to vernalization.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031184 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

KEGG gene cross-reference

ath:AT5G10130

sly:101261755

zma:542292

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.735

Rank 1 · TkA04G106270 · TK1151

Cytoplasm0.113

Rank 2 · TkA04G106270 · TK1151

Lysosome / Vacuole0.081

Rank 3 · TkA04G106270 · TK1151

Endoplasmic reticulum0.078

Rank 4 · TkA04G106270 · TK1151

Cell membrane0.064

Rank 5 · TkA04G106270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01190Pollen_Ole_e_127-154 aa

PF16758UL14146-100 aa

PF11974bMG351-100 aa

PF05688BIg2152-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G106270	`PF01190`	Pollen_Ole_e_1	27	154	1.2e-46	158.9
TkA04G106270	`PF16758`	UL141	46	100	0.15	12.5
TkA04G106270	`PF11974`	bMG3	51	100	0.035	14.8
TkA04G106270	`PF05688`	BIg21	52	90	0.15	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX15`	Arabidopsis thaliana	sp\|Q9LX15\|DFC_ARATH Protein DOWNSTREAM OF FLC	45.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card