LXL04_031184 | RubberDandelionOmics

Gene overview

LXL04_031184

Reference: OH-1004 Chr: Chr07 Coordinates: 1962981-1964317 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · LXL04_031184|LXL04_031184|OH1004|cDNA

ATGGCGAAATCGGTGTTGTTGTTAGCACTATGTGTCCTATTGCCGGCGCTCATCAGTGCTTCACGTCCGATGTCGCGTCCGTTCCTCTTGGAGGGCAGAGTTTACTGCGATACTTGCCGTGCCGGTTTTGAAACCTCCGCCACTTCTTACATTCCTCATGCTAAGGTTAGAGTGGAATGCAAGGACAGGCAACAGAAAGTTCTGTACACCAAGGAGGGAATGGCAGATGCTACAGGAACATACCACATCCATGTGAACGA...

CDS

Download CDS FASTA

480 bp · LXL04_031184|LXL04_031184|OH1004|CDS

ATGGCGAAATCGGTGTTGTTGTTAGCACTATGTGTCCTATTGCCGGCGCTCATCAGTGCTTCACGTCCGATGTCGCGTCCGTTCCTCTTGGAGGGCAGAGTTTACTGCGATACTTGCCGTGCCGGTTTTGAAACCTCCGCCACTTCTTACATTCCTCATGCTAAGGTTAGAGTGGAATGCAAGGACAGGCAACAGAAAGTTCTGTACACCAAGGAGGGAATGGCAGATGCTACAGGAACATACCACATCCATGTGAACGA...

Protein

Download Protein FASTA

159 aa · LXL04_031184|LXL04_031184|OH1004|PROTEIN

MAKSVLLLALCVLLPALISASRPMSRPFLLEGRVYCDTCRAGFETSATSYIPHAKVRVECKDRQQKVLYTKEGMADATGTYHIHVNEDHGDETCDVVLVSSPLDNCNKADPGRDRARVVLTSYNGIVSDTRFANAMGFMKDEVMSGCTALLQSLMEEED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031184`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031184

Location Chr07:1962981-1964317 (-)

Description Similar to DFC: Protein DOWNSTREAM OF FLC

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10130`	Part of a three-gene cluster containing FLC, UFC and DFC, which is coordinately regulated in response to vernalization.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031184 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

KEGG gene cross-reference

ath:AT5G10130

sly:101261755

zma:542292

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.690

Rank 1 · LXL04_031184 · OH-1004

Cytoplasm0.128

Rank 2 · LXL04_031184 · OH-1004

Lysosome / Vacuole0.125

Rank 3 · LXL04_031184 · OH-1004

Endoplasmic reticulum0.086

Rank 4 · LXL04_031184 · OH-1004

Cell membrane0.073

Rank 5 · LXL04_031184 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01190.26Pollen_Ole_e_127-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031184	`PF01190.26`	Pollen_Ole_e_1	27	154	2.8e-47	160.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX15`	Arabidopsis thaliana	Protein DOWNSTREAM OF FLC	46.296%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card