TkA04G102910 | RubberDandelionOmics

Gene overview

TkA04G102910

Reference: TK1151 Chr: Chr04 Coordinates: 26782946-26783941 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

996 bp · TkA04G102910|TK1151|cDNA

ATGGTGGTTGACTCCGGCAGCGATGTTGTGTGGGTCCAATGCTTGCCATGCAAGCAATGCTACCAACAATCAGACCCGCTTTTCGACCCGGCAAACTCAGCTTCTTTTGTGGCCGTCTCTTGCAACTCCCCCGTATGTCAACATGCAGAAACCGCCGTTGGTTGTCACGGCCATGGTGGTGGCCGGTGGTGCAGATATGAAGTTTCTTACGGCGATGGATCCTTCACAAAGGGAACTTTAGCCCTTGAAACACTCAGCTT...

CDS

Download CDS FASTA

996 bp · TkA04G102910|TK1151|CDS

ATGGTGGTTGACTCCGGCAGCGATGTTGTGTGGGTCCAATGCTTGCCATGCAAGCAATGCTACCAACAATCAGACCCGCTTTTCGACCCGGCAAACTCAGCTTCTTTTGTGGCCGTCTCTTGCAACTCCCCCGTATGTCAACATGCAGAAACCGCCGTTGGTTGTCACGGCCATGGTGGTGGCCGGTGGTGCAGATATGAAGTTTCTTACGGCGATGGATCCTTCACAAAGGGAACTTTAGCCCTTGAAACACTCAGCTT...

Protein

Download Protein FASTA

331 aa · TkA04G102910|TK1151|PROTEIN

MVVDSGSDVVWVQCLPCKQCYQQSDPLFDPANSASFVAVSCNSPVCQHAETAVGCHGHGGGRWCRYEVSYGDGSFTKGTLALETLSFGDTFIRNVAIGCGHRNQGLFVGAAGLLGIGGGSMSLVSQLGGEAGGAFSYCLVSRGTGSLGSLEFGRESLPTDSAVWVPLLQNPKAPTFYYVGLSGLGVGGVQVTIPEPIFKLSDMGHGGVVMDTGTAVTRLPTLAYRTFRDAFVAQTSNLPRSRPVSMFDTCFDLNGFVTVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G102910`
TK1151 ID	TkA04G102910
OH-1004 ID	LXL04_035847
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 66.466 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G102910

Location Chr04:26782946-26783941 (+)

Description Similar to ASPG2: Protein ASPARTIC PROTEASE IN GUARD CELL 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20015`	Aspartic protease that may be involved in drought avoidance through abscisic acid signaling.	No verified direct reference in this release
`At3g18490`	Aspartic protease involved in drought avoidance through abscisic acid signaling.	Overexpression of the aspartic protease ASPG1 gene confers drought avoidance in Arabidopsis.2012 · DOI: 10.1093/jxb/err433
`At1g01300`	Aspartyl protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035847 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0070001 aspartic-type peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT3G18490

ath:AT3G20015

ath:AT5G10770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.472

Rank 1 · TkA04G102910 · TK1151

Lysosome / Vacuole0.157

Rank 2 · TkA04G102910 · TK1151

Cell membrane0.138

Rank 3 · TkA04G102910 · TK1151

Cytoplasm0.112

Rank 4 · TkA04G102910 · TK1151

Endoplasmic reticulum0.110

Rank 5 · TkA04G102910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543TAXi_N1-153 aa

PF00026Asp2-38 aa

PF00026Asp66-327 aa

PF14541TAXi_C177-327 aa

PF14543TAXi_N316-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G102910	`PF14543`	TAXi_N	1	153	1.1e-40	140.4
TkA04G102910	`PF00026`	Asp	2	38	4e-14	53.5
TkA04G102910	`PF00026`	Asp	66	327	4e-14	53.5
TkA04G102910	`PF14541`	TAXi_C	177	327	5.6e-32	111.5
TkA04G102910	`PF14543`	TAXi_N	316	328	1.1e-40	140.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHE3`	Arabidopsis thaliana	sp\|Q9LHE3\|ASPG2_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 2	71.300%	Swiss-Prot	High
`Q9LS40`	Arabidopsis thaliana	sp\|Q9LS40\|ASPG1_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 1	53.800%	Swiss-Prot	High
`Q9LNJ3`	Arabidopsis thaliana	sp\|Q9LNJ3\|APF2_ARATH Aspartyl protease family protein 2	51.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card