TkA04G102280 | RubberDandelionOmics

Gene overview

TkA04G102280

Reference: TK1151 Chr: Chr04 Coordinates: 26586737-26587500 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

588 bp · TkA04G102280|TK1151|cDNA

ATGAACCCGAAAGTCGCCATGTCATTAACTAAACTCCGGACTTCTTGCATTGAATTGCTATGTATAGCAATGGCATGGGCGGATTTCAAGACTCAAAATCACTCTGAGCTTCGTGCCAAAATCATTTCCATGTTTTTTAAGTCGTCGACAAGCAGGACATCTGAAATTGTGGTTGTTGATAAAGAGGTTATTTTGCAGCAAAGAATGCCTAAAGAACTTTTGCAAAGCAGCCTGAGTCCTATACTTGTGAACCTGGCACA...

CDS

Download CDS FASTA

492 bp · TkA04G102280|TK1151|CDS

ATGAACCCGAAAGTCGCCATGTCATTAACTAAACTCCGGACTTCTTGCATTGAATTGCTATGTATAGCAATGGCATGGGCGGATTTCAAGACTCAAAATCACTCTGAGCTTCGTGCCAAAATCATTTCCATGTTTTTTAAGTCGTCGACAAGCAGGACATCTGAAATTGTGGTTGTTGATAAAGAGGTTATTTTGCAGCAAAGAATGCCTAAAGAACTTTTGCAAAGCAGCCTGAGTCCTATACTTGTGAACCTGGCACA...

Protein

Download Protein FASTA

163 aa · TkA04G102280|TK1151|PROTEIN

MNPKVAMSLTKLRTSCIELLCIAMAWADFKTQNHSELRAKIISMFFKSSTSRTSEIVVVDKEVILQQRMPKELLQSSLSPILVNLAHTKNLSMPLLQGLVRLLELLSNWFNVALGGKLLEHLKRWLEPEKLQQIQKCWKSGEEPKIAAAIIELFHLLLNTAFW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G102280`
TK1151 ID	TkA04G102280
OH-1004 ID	LXL04_013821
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.100
Protein coverage (%)	TK1151 98.773 / OH-1004 4.254 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G102280`
Location	Chr04:26586737-26587500 (-)
Description	Similar to Nipped-A: Transcription-associated protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013821` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006282 regulation of DNA repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0043484 regulation of RNA splicing Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0051726 regulation of cell cycle Biological Process GO:0140861 DNA repair-dependent chromatin remodeling Biological Process GO:1905168 positive regulation of double-strand break repair via homologous recombination Biological Process GO:2000779 regulation of double-strand break repair Biological Process GO:0000123 histone acetyltransferase complex Cellular Component GO:0000124 SAGA complex Cellular Component
KEGG gene cross-reference	dme:Dmel_CG33554 hsa:8295 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.543

Rank 1 · TkA04G102280 · TK1151

Cytoplasm0.396

Rank 2 · TkA04G102280 · TK1151

Golgi apparatus0.069

Rank 3 · TkA04G102280 · TK1151

Endoplasmic reticulum0.055

Rank 4 · TkA04G102280 · TK1151

Cell membrane0.052

Rank 5 · TkA04G102280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20206Tra1_ring4-158 aa

PF09742Dymeclin9-54 aa

PF16469NPA33-51 aa

PF09742Dymeclin72-108 aa

PF04439Adenyl_transf106-159 aa

PF16469NPA120-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G102280	`PF20206`	Tra1_ring	4	158	2.7e-51	175.0
TkA04G102280	`PF09742`	Dymeclin	9	54	0.21	10.6
TkA04G102280	`PF16469`	NPA	33	51	0.029	15.7
TkA04G102280	`PF09742`	Dymeclin	72	108	0.21	10.6
TkA04G102280	`PF04439`	Adenyl_transf	106	159	0.022	14.7
TkA04G102280	`PF16469`	NPA	120	157	0.029	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card