TkA04G102080 | RubberDandelionOmics

Gene overview

TkA04G102080

Reference: TK1151 Chr: Chr04 Coordinates: 26515886-26517504 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1493 bp · TkA04G102080|TK1151|cDNA

CTTGTTTACCCTTTATCGAAAAAGGGCAAGCCAATGGTTTATTTGAGTCAGCAGTCCATACTCCAGCGAATCCACAAACAAGATTACAACCTCTACAGCTGTCGGAGTCACCACTACAGATCTGATTCAAAATCACGCACTCATACATCAGTACGTTCCCCCAACTCCTTCCTCTTGCCTCAATTCGAATCTGTAACCGAAGATTTGACCTAAATCTGGGTTATCGTACTTTCCCTAGGTTGTATTTGTATACTCATTCG...

CDS

Download CDS FASTA

774 bp · TkA04G102080|TK1151|CDS

ATGGTGTTTTGGGAAGGGTATGTGAGTGATGAAGTGATGGGCACATTTGCCCCAATTGTGGTCTACTGGCTGTACGCGGGGTTTTTCCAGTTGCTACCTCCCCTAGACAATTATCGATTGCACACAAGGAAAGAAGAAGATGCGAAGAACTCAGTGCCATTGAAATCCGTTGTCAAGGGTGTATTGCTTCAACAGCTAGTCCAGGCAGTCGTCGCTCACATCCTGTTTCTGGTAACATCAGAAACAGGCTTAGTTGGGAC...

Protein

Download Protein FASTA

257 aa · TkA04G102080|TK1151|PROTEIN

MVFWEGYVSDEVMGTFAPIVVYWLYAGFFQLLPPLDNYRLHTRKEEDAKNSVPLKSVVKGVLLQQLVQAVVAHILFLVTSETGLVGTEVQPSLTIQLIQIIIAMFVMDTWQYFVHRYMHINKFLYRHIHSQHHKLVVPYAIGALYNHPLEGLLLDTVGGAISFLVSGMTARTAVIFFCFAVVKTVDDHCGLWLPGNLFHLFFQNNTAYHDIHHQLHGLKYNFSQPFFPIWDKVLGTYMAYDLVKRPEGGFEARLSKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G102080`
TK1151 ID	TkA04G102080
OH-1004 ID	LXL04_035862
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 82.903 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G102080

Location Chr04:26515886-26517504 (-)

Description Similar to GL1-9: Very-long-chain aldehyde decarbonylase GL1-9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69640`	Involved in sphingolipid trihydroxy long-chain base (4- hydroxysphinganine) biosynthesis.	Sphingolipid long-chain base hydroxylation is important for growth and regulation of sphingolipid content and composition in Arabidopsis.2008 · DOI: 10.1105/tpc.107.057851
`At1g14290`	Involved in sphingolipid trihydroxy long-chain base (4- hydroxysphinganine) biosynthesis.	Sphingolipid long-chain base hydroxylation is important for growth and regulation of sphingolipid content and composition in Arabidopsis.2008 · DOI: 10.1105/tpc.107.057851

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8B4W4`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release
`Os07g0627700`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035862 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006675 mannosyl-inositol phosphorylceramide metabolic process Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0030148 sphingolipid biosynthetic process Biological Process

GO:0046520 sphingoid biosynthetic process Biological Process

GO:0051999 mannosyl-inositol phosphorylceramide biosynthetic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0042284 sphingolipid delta-4 desaturase activity Molecular Function

KEGG gene cross-reference

ath:AT1G14290

ath:AT1G69640

dosa:Os07g0627700

osa:4343979

spo:2541225

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.879

Rank 1 · TkA04G102080 · TK1151

Cytoplasm0.067

Rank 2 · TkA04G102080 · TK1151

Nucleus0.066

Rank 3 · TkA04G102080 · TK1151

Mitochondrion0.048

Rank 4 · TkA04G102080 · TK1151

Cell membrane0.047

Rank 5 · TkA04G102080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04116FA_hydroxylase68-74 aa

PF248388xMP72-177 aa

PF04116FA_hydroxylase101-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G102080	`PF04116`	FA_hydroxylase	68	74	5.3e-24	85.9
TkA04G102080	`PF24838`	8xMP	72	177	0.11	13.0
TkA04G102080	`PF04116`	FA_hydroxylase	101	236	5.3e-24	85.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYI1`	Arabidopsis thaliana	sp\|Q8VYI1\|SBH1_ARATH Sphinganine C4-monooxygenase 1	66.800%	Swiss-Prot	High
`Q9AST3`	Arabidopsis thaliana	sp\|Q9AST3\|SBH2_ARATH Sphinganine C4-monooxygenase 2	64.400%	Swiss-Prot	High
`B8B4W4`	Oryza sativa subsp. indica	sp\|B8B4W4\|GLO19_ORYSI Very-long-chain aldehyde decarbonylase GL1-9	73.500%	Swiss-Prot	High
`Q0D4G3`	Oryza sativa subsp. japonica	sp\|Q0D4G3\|GLO19_ORYSJ Very-long-chain aldehyde decarbonylase GL1-9	73.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card