RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G099560
Reference: TK1151 Chr: Chr04 Coordinates: 25951352-25954111 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2213 bp · TkA04G099560|TK1151|cDNA

AATTGGGTCGGACCCTCTTTCACCTAGACATTCTATTCAAGGTCCCCCACCCCTTTCACGCGCTCACACGCACACAGACACTCCCTCCGACCCACGCCTCAAGGCTCAAGCACACACAAACACCCTTAACTGTGAGCTCTTTCTGGAGATCCGGACTCATTTATTTCGATTCAGTAAGGTATGCTGGTGTTATATGCAGTTACCAATTGAAAATTTGATGCTTGTAGATCTGATATTCCGTAAAAGAACTTCAGAGCTTG...

CDS

Download CDS FASTA

1014 bp · TkA04G099560|TK1151|CDS

ATGCCTCCATCAAGTAAAGCTGAAAAGAAAGCAGCAATAGATGCTGGAGCATGGATGTTCAACATCGTCACTTCCGTTGGGATCATCATTGTAAACAAAGCATTAATGGCCACATATGGTTTCACTTTTGCAACAACATTGACCGGATTGCATTTCGTCACCACCACCTTGATGACGGTTGTTCTTAGGTGGCTGGGTTACATCCAGCCATCTCATCTACCCATTTCAGAGCTTCTAAAATTCGTCCTATTCGCCAACTT...

Protein

Download Protein FASTA

337 aa · TkA04G099560|TK1151|PROTEIN

MPPSSKAEKKAAIDAGAWMFNIVTSVGIIIVNKALMATYGFTFATTLTGLHFVTTTLMTVVLRWLGYIQPSHLPISELLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVAFDKIRYSRDTKLSILVVLLGVAVCTVTDVSVNAKGFVAAFIAVWTTSLQQYYVHYLQRNYSLSSFNLLGHTAPIQAGSLLVVGPFLDYWLTEKRVDMFKFDVTSVVFLVLSCTIAVGTNLSQFICIGRFTAVSFQVLGH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G099560
TK1151 IDTkA04G099560
OH-1004 IDLXL04_015313
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)52.300
Protein coverage (%)TK1151 86.053 / OH-1004 85.345
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G099560
LocationChr04:25951352-25954111 (+)
DescriptionSimilar to URGT2: UDP-rhamnose/UDP-galactose transporter 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g34020 Nucleotide-sugar transporter that transports UDP-rhamnose or UDP-galactose and UMP in a strict counter-exchange mode. No verified direct reference in this release
At4g09810 Nucleotide-sugar transporter that transports UDP-rhamnose or UDP-galactose and UMP in a strict counter-exchange mode. No verified direct reference in this release
At4g39390 Nucleotide-sugar transporter that transports UDP-rhamnose or UDP-galactose and UMP in a strict counter-exchange mode.
Characterization of AtNST-KT1, a novel UDP-galactose transporter from Arabidopsis thaliana.2006 · DOI: 10.1016/j.febslet.2006.06.082
At1g21070 Nucleotide-sugar transporter that transports UDP-rhamnose or UDP-galactose and UMP in a strict counter-exchange mode. No verified direct reference in this release
At1g76670 Nucleotide-sugar transporter that transports UDP-rhamnose or UDP-galactose and UMP in a strict counter-exchange mode.
Molecular cloning of two Arabidopsis UDP-galactose transporters by complementation of a deficient Chinese hamster ovary cell line.2005 · DOI: 10.1093/glycob/cwh159

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015313 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009624 response to nematode Biological Process
GO:0009833 plant-type primary cell wall biogenesis Biological Process
GO:0015780 nucleotide-sugar transmembrane transport Biological Process
GO:0015783 GDP-fucose transmembrane transport Biological Process
GO:0015786 UDP-glucose transmembrane transport Biological Process
GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process
GO:0055085 transmembrane transport Biological Process
GO:0072334 UDP-galactose transmembrane transport Biological Process
GO:1904659 D-glucose transmembrane transport Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G21070
ath:AT1G76670
ath:AT4G09810
ath:AT4G39390
ath:AT5G42420
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.741
Rank 1 · TkA04G099560 · TK1151
Endoplasmic reticulum0.181
Rank 2 · TkA04G099560 · TK1151
Cytoplasm0.117
Rank 3 · TkA04G099560 · TK1151
Cell membrane0.049
Rank 4 · TkA04G099560 · TK1151
Lysosome / Vacuole0.045
Rank 5 · TkA04G099560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21659Flavi_E_stem7-67 aa
PF03151TPT23-297 aa
PF05366Sarcolipin54-65 aa
PF05366Sarcolipin83-105 aa
PF21659Flavi_E_stem119-144 aa
PF11717Tudor-knot170-180 aa
PF11717Tudor-knot207-217 aa
PF21659Flavi_E_stem262-294 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G099560PF21659Flavi_E_stem7670.008517.2
TkA04G099560PF03151TPT232975.3e-1659.6
TkA04G099560PF05366Sarcolipin54650.8310.1
TkA04G099560PF05366Sarcolipin831050.8310.1
TkA04G099560PF21659Flavi_E_stem1191440.008517.2
TkA04G099560PF11717Tudor-knot1701800.7410.5
TkA04G099560PF11717Tudor-knot2072170.7410.5
TkA04G099560PF21659Flavi_E_stem2622940.008517.2
TkA04G099560PF11717Tudor-knot3033200.7410.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FDZ5Arabidopsis thalianasp|Q9FDZ5|URGT6_ARATH UDP-rhamnose/UDP-galactose transporter 681.900%Swiss-ProtHigh
Q9SZ96Arabidopsis thalianasp|Q9SZ96|URGT5_ARATH UDP-rhamnose/UDP-galactose transporter 581.500%Swiss-ProtHigh
Q8RWW7Arabidopsis thalianasp|Q8RWW7|URGT4_ARATH UDP-rhamnose/UDP-galactose transporter 479.600%Swiss-ProtHigh
Q9LPU2Arabidopsis thalianasp|Q9LPU2|URGT2_ARATH UDP-rhamnose/UDP-galactose transporter 251.300%Swiss-ProtHigh
Q9SRE4Arabidopsis thalianasp|Q9SRE4|URGT1_ARATH UDP-rhamnose/UDP-galactose transporter 151.600%Swiss-ProtHigh

JBrowse

View in Genome Browser