TkA04G098550 | RubberDandelionOmics

Gene overview

TkA04G098550

Reference: TK1151 Chr: Chr04 Coordinates: 25683358-25685801 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1593 bp · TkA04G098550|TK1151|cDNA

AAGGGCATCAACTATATAAACGTAGAGATAGGGTTTTTGTAGCGTTACTGAGCTACCGTCGCCGCACATCCATCTTCGATCTTCAGGTGGAAGAAGGTAAGAATGTCTCACAGGAAGTTTGAGCATCCGAGACACGGTTCTCTTGGGTTTCTTCCCAGGAAGCGTGCTGCTCGCCACAGAGGAAAAGTGAAGGCTTTCCCCAAGGATGACCCAACCAAACCCTGCAAGCTCACCGCCTTCCTGGGCTACAAAGCCGGCAT...

CDS

Download CDS FASTA

1170 bp · TkA04G098550|TK1151|CDS

ATGTCTCACAGGAAGTTTGAGCATCCGAGACACGGTTCTCTTGGGTTTCTTCCCAGGAAGCGTGCTGCTCGCCACAGAGGAAAAGTGAAGGCTTTCCCCAAGGATGACCCAACCAAACCCTGCAAGCTCACCGCCTTCCTGGGCTACAAAGCCGGCATGACTCACATTGTCAGAGACGTCGAGAAACCAGGATCAAAGCTTCACAAGAAAGAGACATGTGAGGCAGTGACAATCATCGAGACACCTCCAATGGTGGTCGT...

Protein

Download Protein FASTA

389 aa · TkA04G098550|TK1151|PROTEIN

MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPTKPCKLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETPPMVVVGVVAYVKTPRGLRSLNTVWAQHLSEDVKRRFYKNWCKSKKKAFAKYSKKLESDEGKKDIQSQLEKMKKYGTVIRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G098550`
TK1151 ID	TkA04G098550
OH-1004 ID	LXL04_035895
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 87.613 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G098550

Location Chr04:25683358-25685801 (+)

Description Similar to RPL3: 60S ribosomal protein L3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g43170`	Large ribosomal subunit protein uL3z.	No verified direct reference in this release
`At1g61580`	Large ribosomal subunit protein uL3y.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0167900`	The L3 protein is a component of the large subunit of cytoplasmic ribosomes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035895 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0006412 translation Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0071353 cellular response to interleukin-4 Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

KEGG gene cross-reference

ath:AT1G43170

ath:AT1G61580

hsa:6122

rno:300079

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.898

Rank 1 · TkA04G098550 · TK1151

Nucleus0.217

Rank 2 · TkA04G098550 · TK1151

Endoplasmic reticulum0.070

Rank 3 · TkA04G098550 · TK1151

Mitochondrion0.028

Rank 4 · TkA04G098550 · TK1151

Cell membrane0.014

Rank 5 · TkA04G098550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00297Ribosomal_L31-370 aa

PF04398DUF538151-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G098550	`PF00297`	Ribosomal_L3	1	370	7.2e-197	654.4
TkA04G098550	`PF04398`	DUF538	151	210	0.16	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P17094`	Arabidopsis thaliana	sp\|P17094\|RL31_ARATH Large ribosomal subunit protein uL3z	89.400%	Swiss-Prot	High
`P22738`	Arabidopsis thaliana	sp\|P22738\|RL32_ARATH Large ribosomal subunit protein uL3y	87.300%	Swiss-Prot	High
`P35684`	Oryza sativa subsp. japonica	sp\|P35684\|RL3_ORYSJ Large ribosomal subunit protein uL3	86.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card