RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G097750
Reference: TK1151 Chr: Chr04 Coordinates: 25469813-25470832 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

951 bp · TkA04G097750|TK1151|cDNA

ATGTTTCTTCTCAAGTTCTTCAGTTGCTTTACGATTTCCGATAATTCCGCAACCGGCGTGAAGAAGTTTTCATGGGAGGAGATAAGAAAACGGACCAGGAATTTCTCAAGGGTCATCGGCTCCGGCGGGTTTAGTACTGTATACCTTGCTCGACTACCGGATTCTGGATTAACCGCCGTGAAAGTCCAATCAGCTTGCACGGAGATGCTCGCCGGAATTTATGAACAAGAGCTTAAGGTCTTGCTCCGATTAAACCACCG...

CDS

Download CDS FASTA

951 bp · TkA04G097750|TK1151|CDS

ATGTTTCTTCTCAAGTTCTTCAGTTGCTTTACGATTTCCGATAATTCCGCAACCGGCGTGAAGAAGTTTTCATGGGAGGAGATAAGAAAACGGACCAGGAATTTCTCAAGGGTCATCGGCTCCGGCGGGTTTAGTACTGTATACCTTGCTCGACTACCGGATTCTGGATTAACCGCCGTGAAAGTCCAATCAGCTTGCACGGAGATGCTCGCCGGAATTTATGAACAAGAGCTTAAGGTCTTGCTCCGATTAAACCACCG...

Protein

Download Protein FASTA

316 aa · TkA04G097750|TK1151|PROTEIN

MFLLKFFSCFTISDNSATGVKKFSWEEIRKRTRNFSRVIGSGGFSTVYLARLPDSGLTAVKVQSACTEMLAGIYEQELKVLLRLNHRNIVKILGYCDDRDDERVLLFEFASNGTLHDKLHVSSSLTLTWKVRKSIALQLAEALEYVHGLHIIHGDIKASNILLDEQQNCKLCDFGSAKLGFTSMVLPPSSTKMKRMIMGSQGYMDPHYLKTGLVSKKNDVYSYGVILLELVTGREAFSLEKSEKLTEVIGPVVSGVVGVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G097750
TK1151 IDTkA04G097750
OH-1004 IDLXL04_018678
Relationship / confidenceMulti Candidate From Tk1151 / Complex relationship
Protein identity (%)35.400
Protein coverage (%)TK1151 92.405 / OH-1004 31.385
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G097750
LocationChr04:25469813-25470832 (+)
DescriptionSimilar to At5g48740: Probable LRR receptor-like serine/threonine-protein kinase At5g48740
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g33260 Probable receptor-like protein kinase At1g33260. No verified direct reference in this release
At4g10390 Probable receptor-like protein kinase At4g10390. No verified direct reference in this release
At5g15730 Calcium/calmodulin-regulated receptor-like kinase 2. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2XW02 Acts probably as a dual specificity protein kinase (Probable). No verified direct reference in this release
Os04g0540900 Acts probably as a dual specificity protein kinase (Probable).
The Receptor-Like Cytoplasmic Kinase STRK1 Phosphorylates and Activates CatC, Thereby Regulating H2O2 Homeostasis and Improving Salt Tolerance in Rice.2018 · DOI: 10.1105/tpc.17.01000
The zinc finger protein DHHC09 S-acylates the kinase STRK1 to regulate H2O2 homeostasis and promote salt tolerance in rice.2024 · DOI: 10.1093/plcell/koae001
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018678 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009877 nodulation Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G67720
ath:AT2G14510
ath:AT5G48740
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.556
Rank 1 · TkA04G097750 · TK1151
Cytoplasm0.343
Rank 2 · TkA04G097750 · TK1151
Nucleus0.233
Rank 3 · TkA04G097750 · TK1151
Endoplasmic reticulum0.051
Rank 4 · TkA04G097750 · TK1151
Golgi apparatus0.048
Rank 5 · TkA04G097750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr35-245 aa
PF00069Pkinase36-302 aa
PF03109ABC137-64 aa
PF01636APH74-147 aa
PF10707YrbL-PhoP_reg85-115 aa
PF12330Haspin_kinase100-179 aa
PF03109ABC1101-177 aa
PF01163RIO1102-175 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G097750PF07714PK_Tyr_Ser-Thr352456.1e-35121.5
TkA04G097750PF00069Pkinase363029.7e-44150.4
TkA04G097750PF03109ABC137645.6e-0626.4
TkA04G097750PF01636APH741470.00318.1
TkA04G097750PF10707YrbL-PhoP_reg851150.1412.6
TkA04G097750PF12330Haspin_kinase1001790.2311.2
TkA04G097750PF03109ABC11011775.6e-0626.4
TkA04G097750PF01163RIO11021750.008316.5
TkA04G097750PF14531Kinase-like1261760.01615.2
TkA04G097750PF06293Kdo1271750.003717.4
TkA04G097750PF10707YrbL-PhoP_reg1311750.1412.6
TkA04G097750PF19974TCAD91421780.02314.6
TkA04G097750PF01636APH1491800.00318.1
TkA04G097750PF01163RIO12242470.008316.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P0DKI6Arabidopsis thalianasp|P0DKI6|Y1332_ARATH Probable receptor-like protein kinase At1g3326043.600%Swiss-ProtMedium
Q9SV83Arabidopsis thalianasp|Q9SV83|Y4103_ARATH Probable receptor-like protein kinase At4g1039044.800%Swiss-ProtMedium
Q9LFV3Arabidopsis thalianasp|Q9LFV3|CRLK2_ARATH Calcium/calmodulin-regulated receptor-like kinase 235.900%Swiss-ProtMedium
A2XW02Oryza sativa subsp. indicasp|A2XW02|STRK1_ORYSI Salt tolerance receptor-like cytoplasmic kinase 147.400%Swiss-ProtMedium
Q7XR88Oryza sativa subsp. japonicasp|Q7XR88|STRK1_ORYSJ Salt tolerance receptor-like cytoplasmic kinase 147.400%Swiss-ProtMedium

JBrowse

View in Genome Browser