TkA04G095660 | RubberDandelionOmics

Gene overview

TkA04G095660

Reference: TK1151 Chr: Chr04 Coordinates: 24903387-24906838 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2402 bp · TkA04G095660|TK1151|cDNA

AAAAAATAAAATCTCAGAAATTGCAGTATATATCTATAACAGACATCTGTGGTATCGCCGCAGACATCTACCTACTCTTTCGCTCCCATTATCGAACCCAAACGAAGATCTAGAGAAGAGTTTTGAGACTGAAAGACAGAGAAACATGGGGAGCACTGAATTTTCATGGAAATTGGCGGATCATCCCAAGCTACCCAAGGGGAAGCTCGTAGCATGATTGTTTTGGATGGGTTGGGGTGAACGCGTCTCCCGATAAGTAC...

CDS

Download CDS FASTA

387 bp · TkA04G095660|TK1151|CDS

ATGGTTGGGCATACTGGTGACGTGGAGGCTACTGTTGTGGCATGCAAAGCTGCTGATGAAGCTGTTAAGATGATTTTGGATGCAGTAAAGGAAGTGGGGGGGATATATGTGGTGACAGCTGACCATGGTAATGCTGAGGATATGGTGAAGAGAAACAAAAAGGGGGAGCCTGCTCTTGATAAGGAGGGGAATGTTCAGATCTTAACTTCCCACACTCTTCAGCCAGTGCCAATTGCTATTGGAGGACCGGGGTTGACAGC...

Protein

Download Protein FASTA

128 aa · TkA04G095660|TK1151|PROTEIN

MVGHTGDVEATVVACKAADEAVKMILDAVKEVGGIYVVTADHGNAEDMVKRNKKGEPALDKEGNVQILTSHTLQPVPIAIGGPGLTAGVKFRKDVPSGGLANVAATVMNLHGFVAPDDYETTLIEVVE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G095660`
TK1151 ID	TkA04G095660
OH-1004 ID	LXL04_035928
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 22.939 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G095660

Location Chr04:24903387-24906838 (-)

Description Similar to PGM1: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g08590`	Catalyzes the interconversion of 2-phosphoglycerate (2-PGA) and 3-phosphoglycerate (3-PGA).	The glycolytic enzyme, phosphoglycerate mutase, has critical roles in stomatal movement, vegetative growth, and pollen production in Arabidopsis thaliana.2011 · DOI: 10.1093/jxb/err223

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035928 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006007 glucose catabolic process Biological Process

GO:0006096 glycolytic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009555 pollen development Biological Process

GO:0009637 response to blue light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0010118 stomatal movement Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

KEGG gene cross-reference

ath:AT1G09780

ath:AT3G08590

zma:542578

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.693

Rank 1 · TkA04G095660 · TK1151

Nucleus0.307

Rank 2 · TkA04G095660 · TK1151

Cell membrane0.110

Rank 3 · TkA04G095660 · TK1151

Mitochondrion0.099

Rank 4 · TkA04G095660 · TK1151

Endoplasmic reticulum0.071

Rank 5 · TkA04G095660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01676Metalloenzyme1-113 aa

PF00245Alk_phosphatase3-57 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G095660	`PF01676`	Metalloenzyme	1	113	1.8e-31	110.3
TkA04G095660	`PF00245`	Alk_phosphatase	3	57	0.02	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9K1`	Arabidopsis thaliana	sp\|Q9M9K1\|PMG2_ARATH Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2	82.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card