TkA04G085000 | RubberDandelionOmics

Gene overview

TkA04G085000

Reference: TK1151 Chr: Chr04 Coordinates: 22279666-22282512 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · TkA04G085000|TK1151|cDNA

ATGAAGCCAGAAAACTTGAGGCGTGCAGCAGCACAGTTGAAGTCTACTCAGCCCGATGAGATTGGTGCCAAGATGGCAAATGCAACACCTAACGAGAATGAGCTTCACAGTCAGGGAAGGTTTACTGATGCTTTGGAGAACTATTCGCGGGCAAGTGCAGCTTTTAAAATCCTATACTTTTATTTCTTTATAACCGATAGAAAAATAATAGCCAAAAACCGATCTACAAAAAACGATAATGTTGATGAGATAAATGATGT...

CDS

Download CDS FASTA

846 bp · TkA04G085000|TK1151|CDS

ATGAAGCCAGAAAACTTGAGGCGTGCAGCAGCACAGTTGAAGTCTACTCAGCCCGATGAGATTGGTGCCAAGATGGCAAATGCAACACCTAACGAGAATGAGCTTCACAGTCAGGGAAGGTTTACTGATGCTTTGGAGAACTATTCGCGGGCAAGTGCAGCTTTTAAAATCCTATACTTTTATTTCTTTATAACCGATAGAAAAATAATAGCCAAAAACCGATCTACAAAAAACGATAATGTTGATGAGATAAATGATGT...

Protein

Download Protein FASTA

281 aa · TkA04G085000|TK1151|PROTEIN

MKPENLRRAAAQLKSTQPDEIGAKMANATPNENELHSQGRFTDALENYSRASAAFKILYFYFFITDRKIIAKNRSTKNDNVDEINDVLIDRFHGQEKVYYSFDEAIDDRNGSYSVEFLNSLTVGGLPPHYLRLKVGCPVILLRNIDPGNGLCNGTRLICRSFQPHVIDAEIAVGQHAGKMVFLPSIPLSPSDDDMFPFKLRRKQFPVRLCFAMTINKAQGQTIPNVGVYLPEPVFSHGQLYVALSRGISRGNTKVLVKLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G085000`
TK1151 ID	TkA04G085000
OH-1004 ID	LXL04_032813
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.200
Protein coverage (%)	TK1151 73.665 / OH-1004 19.696 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G085000`
Location	Chr04:22279666-22282512 (-)
Description	Similar to CLV2: Receptor-like protein CLAVATA2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032813` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007165 signal transduction Biological Process GO:0009653 anatomical structure morphogenesis Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0009908 flower development Biological Process GO:0009909 regulation of flower development Biological Process GO:0010075 regulation of meristem growth Biological Process GO:0010078 maintenance of root meristem identity Biological Process GO:0010088 phloem development Biological Process GO:0030154 cell differentiation Biological Process GO:0040008 regulation of growth Biological Process GO:0045595 regulation of cell differentiation Biological Process GO:0048507 meristem development Biological Process
KEGG gene cross-reference	ath:AT1G65380 dosa:Os04g0576900 osa:4336741 zma:542675 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · TkA04G085000 · TK1151

Nucleus0.324

Rank 2 · TkA04G085000 · TK1151

Peroxisome0.122

Rank 3 · TkA04G085000 · TK1151

Mitochondrion0.073

Rank 4 · TkA04G085000 · TK1151

Plastid0.043

Rank 5 · TkA04G085000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13414TPR_1133-52 aa

PF00515TPR_133-51 aa

PF00515TPR_1102-108 aa

PF21530Pif1_2B_dom116-159 aa

PF01443Viral_helicase1208-246 aa

PF13538UvrD_C_2210-246 aa

PF02689Herpes_Helicase211-272 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G085000	`PF13414`	TPR_11	33	52	0.014	15.8
TkA04G085000	`PF00515`	TPR_1	33	51	0.26	11.9
TkA04G085000	`PF00515`	TPR_1	102	108	0.26	11.9
TkA04G085000	`PF21530`	Pif1_2B_dom	116	159	3.2e-20	72.3
TkA04G085000	`PF01443`	Viral_helicase1	208	246	0.16	12.4
TkA04G085000	`PF13538`	UvrD_C_2	210	246	0.001	19.6
TkA04G085000	`PF02689`	Herpes_Helicase	211	272	0.01	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card