LXL04_032813 | RubberDandelionOmics

Gene overview

LXL04_032813

Reference: OH-1004 Chr: Chr07 Coordinates: 29687196-29695045 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3156 bp · LXL04_032813|LXL04_032813|OH1004|cDNA

ATGTCTGTCCAATCCGCGTCATTTATCAGGAATCTCGTCTGTAAATCGATGGAACCAAGATGGGATTTCTGTTTGAGGACTTGTCGAATCTTTAATTCAAGGTTTACGCCGCTGTTTCTGCTGTTTTTCCTTTCGTTTTCGATGATTTCTTCTTCTGTTGCTAACGAAGATGAAGTATTCGACGAAATTACTCTCGACTTACAAGACAGAGCTTCACTTGTGCTGTTCAAGTCACAGCTCCATGACCCGACGCAGAGATT...

CDS

Download CDS FASTA

3156 bp · LXL04_032813|LXL04_032813|OH1004|CDS

ATGTCTGTCCAATCCGCGTCATTTATCAGGAATCTCGTCTGTAAATCGATGGAACCAAGATGGGATTTCTGTTTGAGGACTTGTCGAATCTTTAATTCAAGGTTTACGCCGCTGTTTCTGCTGTTTTTCCTTTCGTTTTCGATGATTTCTTCTTCTGTTGCTAACGAAGATGAAGTATTCGACGAAATTACTCTCGACTTACAAGACAGAGCTTCACTTGTGCTGTTCAAGTCACAGCTCCATGACCCGACGCAGAGATT...

Protein

Download Protein FASTA

1051 aa · LXL04_032813|LXL04_032813|OH1004|PROTEIN

MSVQSASFIRNLVCKSMEPRWDFCLRTCRIFNSRFTPLFLLFFLSFSMISSSVANEDEVFDEITLDLQDRASLVLFKSQLHDPTQRLSWVGSSCTNWTGVGCSRWNGRVLALNLTGFNLSGQLHPSLCKLSFLETLYLSRNSLSGQIPACFSSLWSIKILDLSYNMLSGVIPNTLVKLSRLTQLDFSHNLFDQMLPYWIGNFSLKLEKIEMGFNSFRGEIPESLLQLKSLKYLGLSHNKFSGNLPDFRQALEHLSLESNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032813`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032813

Location Chr07:29687196-29695045 (+)

Description Similar to CLV2: Receptor-like protein CLAVATA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65380`	Involved in the perception of CLV3 and CLV3-like (CLE) peptides, that act as extracellular signals regulating meristems maintenance.	The Arabidopsis CLAVATA2 gene encodes a receptor-like protein required for the stability of the CLAVATA1 receptor-like kinase.1999 · DOI: 10.1105/tpc.11.10.1925 The 14-amino acid CLV3, CLE19, and CLE40 peptides trigger consumption of the root meristem in Arabidopsis through a CLAVATA2-dependent pathway.2005 · DOI: 10.1105/tpc.105.034009 Functional analyses of the CLAVATA2-like proteins and their domains that contribute to CLAVATA2 specificity.2010 · DOI: 10.1104/pp.109.148197 Stem cell signaling in Arabidopsis requires CRN to localize CLV2 to the plasma membrane.2010 · DOI: 10.1104/pp.109.149930 CLE14/CLE20 peptides may interact with CLAVATA2/CORYNE receptor-like kinases to irreversibly inhibit cell division in the root meristem of Arabidopsis.2010 · DOI: 10.1007/s00425-010-1236-4 Nematode CLE signaling in Arabidopsis requires CLAVATA2 and CORYNE.2011 · DOI: 10.1111/j.1365-313x.2010.04433.x Mechanisms of molecular mimicry of plant CLE peptide ligands by the parasitic nematode Globodera rostochiensis.2011 · DOI: 10.1104/pp.111.180554 Perception of root-active CLE peptides requires CORYNE function in the phloem vasculature.2017 · DOI: 10.15252/embr.201643535 CLAVATA2, a regulator of meristem and organ development in Arabidopsis.1998 · DOI: 10.1242/dev.125.19.3843
`At1g08590`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	No verified direct reference in this release
`At4g36180`	Probable LRR receptor-like serine/threonine-protein kinase At4g36180.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0576900`	Functions in the early stages of organ development by regulating cell division rate.	XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassinosteroids and cell cycling in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04877.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032813 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009653 anatomical structure morphogenesis Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010088 phloem development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0040008 regulation of growth Biological Process

GO:0045595 regulation of cell differentiation Biological Process

GO:0048507 meristem development Biological Process

KEGG gene cross-reference

ath:AT1G65380

dosa:Os04g0576900

osa:4336741

zma:542675

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.497

Rank 1 · LXL04_032813 · OH-1004

Endoplasmic reticulum0.172

Rank 2 · LXL04_032813 · OH-1004

Lysosome / Vacuole0.145

Rank 3 · LXL04_032813 · OH-1004

Cytoplasm0.089

Rank 4 · LXL04_032813 · OH-1004

Nucleus0.061

Rank 5 · LXL04_032813 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14108-309 aa

PF13855.13LRR_8133-190 aa

PF13855.13LRR_8251-309 aa

PF13855.13LRR_8322-384 aa

PF23598.2LRR_14350-454 aa

PF12799.14LRR_4372-411 aa

PF13855.13LRR_8443-480 aa

PF12799.14LRR_4445-485 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032813	`PF23598.2`	LRR_14	108	309	2e-19	70.3
LXL04_032813	`PF13855.13`	LRR_8	133	190	1.3e-47	160.0
LXL04_032813	`PF13855.13`	LRR_8	251	309	1.3e-47	160.0
LXL04_032813	`PF13855.13`	LRR_8	322	384	1.3e-47	160.0
LXL04_032813	`PF23598.2`	LRR_14	350	454	2e-19	70.3
LXL04_032813	`PF12799.14`	LRR_4	372	411	3.6e-38	129.4
LXL04_032813	`PF13855.13`	LRR_8	443	480	1.3e-47	160.0
LXL04_032813	`PF12799.14`	LRR_4	445	485	3.6e-38	129.4
LXL04_032813	`PF13855.13`	LRR_8	486	528	1.3e-47	160.0
LXL04_032813	`PF13855.13`	LRR_8	573	610	1.3e-47	160.0
LXL04_032813	`PF21530.4`	Pif1_2B_dom	886	928	3.1e-19	69.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80809`	Arabidopsis thaliana	Receptor-like protein CLAVATA2	60.976%	Swiss-Prot	moderate database homology
`Q9FRS6`	Arabidopsis thaliana	Leucine-rich repeat receptor-like protein kinase PXL1	32.956%	Swiss-Prot	moderate database homology
`C0LGS2`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At4g36180	33.539%	Swiss-Prot	moderate database homology
`G9LZD7`	Oryza sativa subsp. japonica	Probable inactive leucine-rich repeat receptor kinase XIAO	33.043%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card