TkA04G084480 | RubberDandelionOmics

Gene overview

TkA04G084480

Reference: TK1151 Chr: Chr04 Coordinates: 22121705-22129104 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2237 bp · TkA04G084480|TK1151|cDNA

ATTCCTGAATCCGTCCATGAGCATACCAAACCACCAAACCACAAAGACAAATGAATAGTCACCAAAATTCTCTAATTCTAATACTAAAGCCTTTGGGAAAAGTGTCGATTAGTCGATTACTTTATCTAAACTCTGTTGTGATGGACGGCAGAGAAAACTACGCACCGGCGATCGGCATCGACCTCGGAACAACGTACTCATGTGTCGCCGTTTGGAAACATGATCGCATCGAAATTATTCCGAATGATCAGGGCAACAGA...

CDS

Download CDS FASTA

1923 bp · TkA04G084480|TK1151|CDS

ATGAATAGTCACCAAAATTCTCTAATTCTAATACTAAAGCCTTTGGGAAAAGTGTCGATTAGTCGATTACTTTATCTAAACTCTGTTGTGATGGACGGCAGAGAAAACTACGCACCGGCGATCGGCATCGACCTCGGAACAACGTACTCATGTGTCGCCGTTTGGAAACATGATCGCATCGAAATTATTCCGAATGATCAGGGCAACAGAACCACACCCTCTTGTGTTGCTTTCGACGATACTGAACGCCTCATAGGCGA...

Protein

Download Protein FASTA

640 aa · TkA04G084480|TK1151|PROTEIN

MNSHQNSLILILKPLGKVSISRLLYLNSVVMDGRENYAPAIGIDLGTTYSCVAVWKHDRIEIIPNDQGNRTTPSCVAFDDTERLIGDGAKNQAAMNPANTIYDAKRLIGRRFSDAKVQDDIKLWPFKVIEGSADTPKIVVSYKGQDKEFLAEEISSMILGKMKETAEAYLGKVVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVIRIINEPTAAAIAYGLDNKPNITGTINVLVFDLGGGTFDVSILSIEDGETFEVKAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G084480`
TK1151 ID	TkA04G084480
OH-1004 ID	LXL04_036010
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.800
Protein coverage (%)	TK1151 92.188 / OH-1004 41.785 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G084480

Location Chr04:22121705-22129104 (+)

Description Similar to HSP70: Heat shock cognate 70 kDa protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12580`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions (Probable).	Comprehensive expression profile analysis of the Arabidopsis Hsp70 gene family.2001 · DOI: 10.1104/pp.126.2.789 Heat shock protein cognate 70-4 and an E3 ubiquitin ligase, CHIP, mediate plastid-destined precursor degradation through the ubiquitin-26S proteasome system in Arabidopsis.2009 · DOI: 10.1105/tpc.109.071548
`At3g09440`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At5g02490`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At1g16030`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At5g02500`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions (Probable).	Physiological and molecular assessment of altered expression of Hsc70-1 in Arabidopsis. Evidence for pleiotropic consequences.2003 · DOI: 10.1104/pp.102.019398 Interaction between SGT1 and cytosolic/nuclear HSC70 chaperones regulates Arabidopsis immune responses.2007 · DOI: 10.1105/tpc.107.051896 WPP-domain proteins mimic the activity of the HSC70-1 chaperone in preventing mistargeting of RanGAP1-anchoring protein WIT1.2009 · DOI: 10.1104/pp.109.143404 The cytosolic/nuclear HSC70 and HSP90 molecular chaperones are important for stomatal closure and modulate abscisic acid-dependent physiological responses in Arabidopsis.2011 · DOI: 10.1104/pp.111.174425

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036010 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006457 protein folding Biological Process

GO:0006950 response to stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009615 response to virus Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0010286 heat acclimation Biological Process

GO:0042026 protein refolding Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0090332 stomatal closure Biological Process

GO:0098542 defense response to other organism Biological Process

KEGG gene cross-reference

ath:AT5G02500

sly:101247772

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.598

Rank 1 · TkA04G084480 · TK1151

Nucleus0.297

Rank 2 · TkA04G084480 · TK1151

Mitochondrion0.135

Rank 3 · TkA04G084480 · TK1151

Cell membrane0.078

Rank 4 · TkA04G084480 · TK1151

Endoplasmic reticulum0.057

Rank 5 · TkA04G084480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012HSP7040-636 aa

PF06723MreB_Mbl40-55 aa

PF04010DUF357164-193 aa

PF06723MreB_Mbl172-419 aa

PF07318DUF1464342-430 aa

PF04010DUF357535-585 aa

PF14235DUF4337545-582 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G084480	`PF00012`	HSP70	40	636	1.7e-228	760.5
TkA04G084480	`PF06723`	MreB_Mbl	40	55	2.8e-16	60.0
TkA04G084480	`PF04010`	DUF357	164	193	0.03	15.0
TkA04G084480	`PF06723`	MreB_Mbl	172	419	2.8e-16	60.0
TkA04G084480	`PF07318`	DUF1464	342	430	0.12	12.3
TkA04G084480	`PF04010`	DUF357	535	585	0.03	15.0
TkA04G084480	`PF14235`	DUF4337	545	582	0.13	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHA8`	Arabidopsis thaliana	sp\|Q9LHA8\|HS704_ARATH Heat shock 70 kDa protein 4	65.500%	Swiss-Prot	High
`O65719`	Arabidopsis thaliana	sp\|O65719\|HSP7C_ARATH Heat shock 70 kDa protein 3	65.300%	Swiss-Prot	High
`P22954`	Arabidopsis thaliana	sp\|P22954\|HS702_ARATH Heat shock 70 kDa protein 2	63.500%	Swiss-Prot	High
`Q9S9N1`	Arabidopsis thaliana	sp\|Q9S9N1\|HSP7E_ARATH Heat shock 70 kDa protein 5	60.600%	Swiss-Prot	High
`P22953`	Arabidopsis thaliana	sp\|P22953\|HS701_ARATH Heat shock 70 kDa protein 1	71.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card