TkA04G078980 | RubberDandelionOmics

Gene overview

TkA04G078980

Reference: TK1151 Chr: Chr04 Coordinates: 20708226-20711390 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3165 bp · TkA04G078980|TK1151|cDNA

ATGAGTACCGAAGTCAGCTTTCAGATTTTGTTGATGGGGTTGTACGTGATCATGTTTGGTGTTATGTCCACATCGGTTTCTGGTCAATGTCAAATCGACCAGCAATCGATTTTAATCCGGTTGAAGAAGGAGTTACACTTCAGTTCTTCATTATCAACAAAACTAGTGTCTTGGGACCCAAATGTGACAGATTGTTGCACCTGGGTAGGAGTTAATTGCAGCATCGAGGGTGAAGTTATAGGTCTAGATTTAAGCAACGA...

CDS

Download CDS FASTA

3165 bp · TkA04G078980|TK1151|CDS

ATGAGTACCGAAGTCAGCTTTCAGATTTTGTTGATGGGGTTGTACGTGATCATGTTTGGTGTTATGTCCACATCGGTTTCTGGTCAATGTCAAATCGACCAGCAATCGATTTTAATCCGGTTGAAGAAGGAGTTACACTTCAGTTCTTCATTATCAACAAAACTAGTGTCTTGGGACCCAAATGTGACAGATTGTTGCACCTGGGTAGGAGTTAATTGCAGCATCGAGGGTGAAGTTATAGGTCTAGATTTAAGCAACGA...

Protein

Download Protein FASTA

1054 aa · TkA04G078980|TK1151|PROTEIN

MSTEVSFQILLMGLYVIMFGVMSTSVSGQCQIDQQSILIRLKKELHFSSSLSTKLVSWDPNVTDCCTWVGVNCSIEGEVIGLDLSNETISAGIDGSSALFGLKNLETLNLAGNYFNFTPIPSRFGSLTNLRNLNLSNSWFSSQIPGELSQLTNLQVLDLSSLFSGIRSLKLENPNLGMLVGNLTQIRVLALDSVNISAQKSDWCQALSSSLLHLEVLSLSNCQLSGPLDDSLGKLKSLSVICLAQNNLNTSVPDFFGDFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G078980`
TK1151 ID	TkA04G078980
OH-1004 ID	LXL04_036049
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.000
Protein coverage (%)	TK1151 96.774 / OH-1004 89.771 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G078980

Location Chr04:20708226-20711390 (-)

Description Similar to RLP7: Receptor-like protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11080`	Receptor-like protein 35.	No verified direct reference in this release
`At5g27060`	Receptor-like protein 53.	No verified direct reference in this release
`At3g05660`	Receptor-like protein 33.	No verified direct reference in this release
`At2g33060`	Receptor like protein 27.	No verified direct reference in this release
`At1g47890`	Receptor-like protein 7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036049 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0051707 response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G45616

ath:AT1G47890

ath:AT2G15080

ath:AT3G05660

ath:AT3G11010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.868

Rank 1 · TkA04G078980 · TK1151

Endoplasmic reticulum0.088

Rank 2 · TkA04G078980 · TK1151

Cytoplasm0.057

Rank 3 · TkA04G078980 · TK1151

Nucleus0.046

Rank 4 · TkA04G078980 · TK1151

Lysosome / Vacuole0.024

Rank 5 · TkA04G078980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_234-74 aa

PF13855LRR_882-114 aa

PF12799LRR_482-113 aa

PF24758LRR_At5g5637082-180 aa

PF13306LRR_598-159 aa

PF25013LRR_Zer-199-202 aa

PF23598LRR_14102-215 aa

PF13516LRR_6103-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G078980	`PF08263`	LRRNT_2	34	74	5.3e-07	30.5
TkA04G078980	`PF13855`	LRR_8	82	114	1.3e-55	185.7
TkA04G078980	`PF12799`	LRR_4	82	113	9.4e-49	163.1
TkA04G078980	`PF24758`	LRR_At5g56370	82	180	1.6e-12	48.3
TkA04G078980	`PF13306`	LRR_5	98	159	0.031	14.9
TkA04G078980	`PF25013`	LRR_Zer-1	99	202	2.3e-10	41.5
TkA04G078980	`PF23598`	LRR_14	102	215	1.6e-36	126.6
TkA04G078980	`PF13516`	LRR_6	103	113	1.4e-07	31.8
TkA04G078980	`PF00560`	LRR_1	104	127	1.6e-61	191.6
TkA04G078980	`PF24141`	LRR_ComC	113	145	1.3e-07	32.3
TkA04G078980	`PF24048`	LRR_NXF1-5	116	159	0.46	10.8
TkA04G078980	`PF13855`	LRR_8	124	161	1.3e-55	185.7
TkA04G078980	`PF13516`	LRR_6	127	138	1.4e-07	31.8
TkA04G078980	`PF12799`	LRR_4	128	161	9.4e-49	163.1
TkA04G078980	`PF00560`	LRR_1	129	151	1.6e-61	191.6
TkA04G078980	`PF07723`	LRR_2	129	142	0.097	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRL7`	Arabidopsis thaliana	sp\|Q9SRL7\|RLP35_ARATH Receptor-like protein 35	31.800%	Swiss-Prot	Low
`Q9S9U3`	Arabidopsis thaliana	sp\|Q9S9U3\|RLP53_ARATH Receptor-like protein 53	33.200%	Swiss-Prot	Low
`F4J8G2`	Arabidopsis thaliana	sp\|F4J8G2\|RLP33_ARATH Receptor-like protein 33	40.700%	Swiss-Prot	Low
`F4IUU1`	Arabidopsis thaliana	sp\|F4IUU1\|RLP27_ARATH Receptor like protein 27	41.700%	Swiss-Prot	Low
`Q9C699`	Arabidopsis thaliana	sp\|Q9C699\|RLP7_ARATH Receptor-like protein 7	41.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card