TkA04G076370 | RubberDandelionOmics

Gene overview

TkA04G076370

Reference: TK1151 Chr: Chr04 Coordinates: 20078300-20078767 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA04G076370|TK1151|cDNA

ATGACGGCTCAAGACGTGTCCACTATGATGCGATGTGGGCAAAACAGCATCATATTTCTGATAAACAACGGCGGTTACACTATTGAAGTACAAATCCATGATGGGCCGTACAATGTGATCAAGAATTGGAACTATACTGGATTAGTTGAAGCAATCCATAACGGTCAAGGCAATTGCTGGACCACCAAGGTGTTTTGCGAAGAAGATTTGGTTAAAGCGATTGAGATAGCGACAGGAGAGAAGAAGGATTGCTTGTGTTT...

CDS

Download CDS FASTA

345 bp · TkA04G076370|TK1151|CDS

ATGACGGCTCAAGACGTGTCCACTATGATGCGATGTGGGCAAAACAGCATCATATTTCTGATAAACAACGGCGGTTACACTATTGAAGTACAAATCCATGATGGGCCGTACAATGTGATCAAGAATTGGAACTATACTGGATTAGTTGAAGCAATCCATAACGGTCAAGGCAATTGCTGGACCACCAAGGTGTTTTGCGAAGAAGATTTGGTTAAAGCGATTGAGATAGCGACAGGAGAGAAGAAGGATTGCTTGTGTTT...

Protein

Download Protein FASTA

114 aa · TkA04G076370|TK1151|PROTEIN

MTAQDVSTMMRCGQNSIIFLINNGGYTIEVQIHDGPYNVIKNWNYTGLVEAIHNGQGNCWTTKVFCEEDLVKAIEIATGEKKDCLCFIEVMAHKDDTSKELLEWGSRVAAANPH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G076370`
TK1151 ID	TkA04G076370
OH-1004 ID	LXL04_036095
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 31.233 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G076370

Location Chr04:20078300-20078767 (+)

Description Similar to PDC2: Pyruvate decarboxylase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XFI3`	Pyruvate decarboxylase 2.	No verified direct reference in this release
`Os03g0293500`	Pyruvate decarboxylase 2.	No verified direct reference in this release
`UniProt: A2Y5L9`	Pyruvate decarboxylase 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036095 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000949 aromatic amino acid family catabolic process to alcohol via Ehrlich pathway Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0006950 response to stress Biological Process

GO:0034059 response to anoxia Biological Process

GO:0036293 response to decreased oxygen levels Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0090548 response to nitrate starvation Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004737 pyruvate decarboxylase activity Molecular Function

KEGG gene cross-reference

ath:AT4G33070

ath:AT5G01320

dosa:Os03g0293500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.758

Rank 1 · TkA04G076370 · TK1151

Nucleus0.377

Rank 2 · TkA04G076370 · TK1151

Mitochondrion0.052

Rank 3 · TkA04G076370 · TK1151

Extracellular0.046

Rank 4 · TkA04G076370 · TK1151

Peroxisome0.038

Rank 5 · TkA04G076370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02775TPP_enzyme_C1-90 aa

PF08531Bac_rhamnosid_N3-47 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G076370	`PF02775`	TPP_enzyme_C	1	90	0.0022	18.5
TkA04G076370	`PF08531`	Bac_rhamnosid_N	3	47	0.053	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2XFI3`	Oryza sativa subsp. indica	sp\|A2XFI3\|PDC2_ORYSI Pyruvate decarboxylase 2	85.600%	Swiss-Prot	High
`Q10MW3`	Oryza sativa subsp. japonica	sp\|Q10MW3\|PDC2_ORYSJ Pyruvate decarboxylase 2	84.700%	Swiss-Prot	High
`A2Y5L9`	Oryza sativa subsp. indica	sp\|A2Y5L9\|PDC1_ORYSI Pyruvate decarboxylase 1	81.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card