LXL04_036095 | RubberDandelionOmics

Gene overview

LXL04_036095

Reference: OH-1004 Chr: Chr08 Coordinates: 35553640-35554952 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1098 bp · LXL04_036095|LXL04_036095|OH1004|cDNA

ATGGGTTTGGAAGCCGCCGTGGAGGCTGCAACAGTGTTCTTGAACAAAGCAGTGAAACCAGTAATGGTGGGAGGACCCAAACTCCGAGTAGCAAACGCCTGCCAGGCGTTTGTTGAATTCGCAGATGCTTCAGGATATGCTTTCGCAGTATCACCGTCAGGAAAAGGCTTAGTTCCCGAGCACCATCCTCACTTCATCGGGACATATTGGGGAGCTGTAAGCACCGCTTTCTGTTCAGAAATCGTCGAATCAGCAGATGC...

CDS

Download CDS FASTA

1098 bp · LXL04_036095|LXL04_036095|OH1004|CDS

ATGGGTTTGGAAGCCGCCGTGGAGGCTGCAACAGTGTTCTTGAACAAAGCAGTGAAACCAGTAATGGTGGGAGGACCCAAACTCCGAGTAGCAAACGCCTGCCAGGCGTTTGTTGAATTCGCAGATGCTTCAGGATATGCTTTCGCAGTATCACCGTCAGGAAAAGGCTTAGTTCCCGAGCACCATCCTCACTTCATCGGGACATATTGGGGAGCTGTAAGCACCGCTTTCTGTTCAGAAATCGTCGAATCAGCAGATGC...

Protein

Download Protein FASTA

365 aa · LXL04_036095|LXL04_036095|OH1004|PROTEIN

MGLEAAVEAATVFLNKAVKPVMVGGPKLRVANACQAFVEFADASGYAFAVSPSGKGLVPEHHPHFIGTYWGAVSTAFCSEIVESADAYVFAGPIFNDYSSVIVGYSLLLKKEKTLLIQLDRVVIGNGPTFGCILMKDFLRALAKRVKKNTTAYENYRRIYVPEGNLPPCVPKEPLRVNVLFGHIQKMLSSDTAVIAETGDSWFNCQKLKLPKGCGCNQYGSIGWSVGATLGYAQAAIDKRVIACIGDGSFQMTAQDVSTM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036095`
TK1151 ID	TkA04G076370
OH-1004 ID	LXL04_036095
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 31.233 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036095

Location Chr08:35553640-35554952 (-)

Description Similar to PDC2: Pyruvate decarboxylase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33070`	May play a role in ethanolic fermentation during anoxia.	The pyruvate decarboxylase1 gene of Arabidopsis is required during anoxia but not other environmental stresses.2003 · DOI: 10.1104/pp.102.016907
`At5g01320`	Pyruvate decarboxylase 4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XFI3`	Pyruvate decarboxylase 2.	No verified direct reference in this release
`Os03g0293500`	Pyruvate decarboxylase 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036095 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000949 aromatic amino acid family catabolic process to alcohol via Ehrlich pathway Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0006950 response to stress Biological Process

GO:0034059 response to anoxia Biological Process

GO:0036293 response to decreased oxygen levels Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0090548 response to nitrate starvation Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004737 pyruvate decarboxylase activity Molecular Function

KEGG gene cross-reference

ath:AT4G33070

ath:AT5G01320

dosa:Os03g0293500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.768

Rank 1 · LXL04_036095 · OH-1004

Nucleus0.268

Rank 2 · LXL04_036095 · OH-1004

Mitochondrion0.064

Rank 3 · LXL04_036095 · OH-1004

Peroxisome0.056

Rank 4 · LXL04_036095 · OH-1004

Endoplasmic reticulum0.053

Rank 5 · LXL04_036095 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00205.29TPP_enzyme_M8-126 aa

PF02775.27TPP_enzyme_C216-340 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036095	`PF00205.29`	TPP_enzyme_M	8	126	1.5e-20	74.0
LXL04_036095	`PF02775.27`	TPP_enzyme_C	216	340	1.7e-15	57.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82647`	Arabidopsis thaliana	Pyruvate decarboxylase 1	79.781%	Swiss-Prot	strong database homology
`Q9M040`	Arabidopsis thaliana	Pyruvate decarboxylase 4	79.508%	Swiss-Prot	strong database homology
`A2XFI3`	Oryza sativa subsp. indica	Pyruvate decarboxylase 2	79.781%	Swiss-Prot	strong database homology
`Q10MW3`	Oryza sativa subsp. japonica	Pyruvate decarboxylase 2	79.508%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card