TkA04G067350 | RubberDandelionOmics

Gene overview

TkA04G067350

Reference: TK1151 Chr: Chr04 Coordinates: 17853116-17856440 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

735 bp · TkA04G067350|TK1151|cDNA

CTACTTCGTCAGCCAGCCCTACTCTTCAATCGCTCCCAAAGCACCCCTTGAGCTTGAAGAATGCCATCGTTTCCTCAGCCAGGCTCAGTTACTGTATGCGAAATCAACAGAGATCTAATTACCGCTGAAAGTTTTTCGGAGGATCAAGCAAAGGAAACTTATGGAAAAGTTCTTGGAGTAGTATTCGGTCCAATTTCGTACCAGTTGGAGTATCCACCGTCGCCACATCCCGATAGAGGCGTAGAACTGCCAGTGAATCG...

CDS

Download CDS FASTA

1317 bp · TkA04G067350|TK1151|CDS

ATGCCATCGTTTCCTCAGCCAGGCTCAGTTACTGTATGCGAAATCAACAGAGATCTAATTACCGCTGAAAGTTTTTCGGAGGATCAAGCAAAGGAAACTTATGGAAAAGTTCTTGGAGTAGTATTCGGTCCAATTTCGTACCAGTTGGAGTATCCACCGTCGCCACATCCCGATAGAGGCGTAGAACTGCCAGTGAATCGTTTATCGCGTTTACTTCAAGCAGTCTCTTATGGTCCGCTTAAAAGCCTTCTTGGTTCAGA...

Protein

Download Protein FASTA

438 aa · TkA04G067350|TK1151|PROTEIN

MPSFPQPGSVTVCEINRDLITAESFSEDQAKETYGKVLGVVFGPISYQLEYPPSPHPDRGVELPVNRLSRLLQAVSYGPLKSLLGSDDVKLLQHVDLKCVGWHQKKDILAFISARNQVTIRDYGDSEGKEPCILMNDLQREAKLLEWRPNAGKTLSVGCKGGICIWAASYPGNTACVRPGVSSGSLSRGSGVKWTLVDFLRVHSDEQITALSWSPDGRYVASASYGSSSFTIWDAAQGVGTPLRRGFGSISLLKWSPTRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G067350`
TK1151 ID	TkA04G067350
OH-1004 ID	LXL04_036173
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G067350

Location Chr04:17853116-17856440 (+)

Description Similar to AAAS: Aladin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56900`	Aladin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036173 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001578 microtubule bundle formation Biological Process

GO:0006749 glutathione metabolic process Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009566 fertilization Biological Process

GO:0015031 protein transport Biological Process

GO:0035264 multicellular organism growth Biological Process

GO:0046822 regulation of nucleocytoplasmic transport Biological Process

GO:0051028 mRNA transport Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:1902365 positive regulation of protein localization to spindle pole body Biological Process

GO:0000922 spindle pole Cellular Component

KEGG gene cross-reference

ath:AT3G56900

dme:Dmel_CG16892

hsa:8086

mmu:223921

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.495

Rank 1 · TkA04G067350 · TK1151

Nucleus0.311

Rank 2 · TkA04G067350 · TK1151

Cell membrane0.147

Rank 3 · TkA04G067350 · TK1151

Golgi apparatus0.118

Rank 4 · TkA04G067350 · TK1151

Lysosome / Vacuole0.105

Rank 5 · TkA04G067350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23383Beta-prop_IFT140_1st90-172 aa

PF24797Beta-prop_WDR35_TULP_N92-123 aa

PF25460Beta-prop_Aladin94-430 aa

PF24817WD40_WDHD1_1st96-169 aa

PF23381Beta-prop_IFT122_1st97-160 aa

PF23414Beta-prop_EML_297-238 aa

PF25174Beta-prop_THOC398-160 aa

PF23389Beta-prop_WDR19_1st98-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G067350	`PF23383`	Beta-prop_IFT140_1st	90	172	1.5e-07	31.2
TkA04G067350	`PF24797`	Beta-prop_WDR35_TULP_N	92	123	1.6e-05	24.9
TkA04G067350	`PF25460`	Beta-prop_Aladin	94	430	1.1e-52	180.0
TkA04G067350	`PF24817`	WD40_WDHD1_1st	96	169	1.5e-11	44.8
TkA04G067350	`PF23381`	Beta-prop_IFT122_1st	97	160	5e-14	53.0
TkA04G067350	`PF23414`	Beta-prop_EML_2	97	238	4.1e-09	36.9
TkA04G067350	`PF25174`	Beta-prop_THOC3	98	160	5.6e-15	55.8
TkA04G067350	`PF23389`	Beta-prop_WDR19_1st	98	163	6.7e-10	39.2
TkA04G067350	`PF24814`	WD40_Prp19	98	126	1e-06	28.7
TkA04G067350	`PF24807`	WD40_CDC20-Fz	101	163	4.1e-10	40.2
TkA04G067350	`PF12894`	ANAPC4_WD40	102	174	5.5e-16	59.3
TkA04G067350	`PF23775`	Beta-prop_RIG_2nd	104	170	2.1e-06	28.1
TkA04G067350	`PF25175`	Beta-prop_WDR5	110	151	7.4e-10	39.3
TkA04G067350	`PF24105`	Beta-prop_CAF1B_HIR1	144	238	1.1e-09	38.4
TkA04G067350	`PF00400`	WD40	152	166	3.6e-13	50.1
TkA04G067350	`PF00400`	WD40	196	234	3.6e-13	50.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWR1`	Arabidopsis thaliana	sp\|Q8GWR1\|AAAS_ARATH Aladin	64.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card