TkA04G067200 | RubberDandelionOmics

Gene overview

TkA04G067200

Reference: TK1151 Chr: Chr04 Coordinates: 17807462-17808195 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · TkA04G067200|TK1151|cDNA

ATGCATTATGACCCCATGATTGCCAAGCTTGTAGTATGGGGAGAAGAAGGGGACACTGTAAGCATGCATTATGACCCCATGATTGCCAAGCTTGTAGTATGGGGAGAAAATAGTGCTTGTGATTTAATCAAATTAAATGATTCCTTATCAAAGTTTCAGAAAGTTGGTCATGGAAGCAATGAAAATGGAGCTGTAAAAGCTTCATCATCTTCTACTGATCCAATAACAGTGGGACAAATGAAAATTTTGTTGGGCTTTTT...

CDS

Download CDS FASTA

468 bp · TkA04G067200|TK1151|CDS

ATGCATTATGACCCCATGATTGCCAAGCTTGTAGTATGGGGAGAAGAAGGGGACACTGTAAGCATGCATTATGACCCCATGATTGCCAAGCTTGTAGTATGGGGAGAAAATAGTGCTTGTGATTTAATCAAATTAAATGATTCCTTATCAAAGTTTCAGAAAGTTGGTCATGGAAGCAATGAAAATGGAGCTGTAAAAGCTTCATCATCTTCTACTGATCCAATAACAGTGGGACAAATGAAAATTTTGTTGGGCTTTTT...

Protein

Download Protein FASTA

155 aa · TkA04G067200|TK1151|PROTEIN

MHYDPMIAKLVVWGEEGDTVSMHYDPMIAKLVVWGENSACDLIKLNDSLSKFQKVGHGSNENGAVKASSSSTDPITVGQMKILLGFLRSIINNLTPNPKLSAVFKSMNIQMPKTSTGSTSTVNQSSSSKSDQMQGKMTILPFLMFHLSYICYDRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G067200`
TK1151 ID	TkA04G067200
OH-1004 ID	LXL04_036168
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G067200`
Location	Chr04:17807462-17808195 (+)
Description	Similar to MCCA: Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036168` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006552 L-leucine catabolic process Biological Process GO:0006768 biotin metabolic process Biological Process GO:0009083 branched-chain amino acid catabolic process Biological Process GO:0005576 extracellular region Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005829 cytosol Cellular Component GO:0022626 cytosolic ribosome Cellular Component GO:1905202 methylcrotonoyl-CoA carboxylase complex Cellular Component GO:0004075 biotin carboxylase activity Molecular Function GO:0004485 methylcrotonoyl-CoA carboxylase activity Molecular Function GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	ath:AT1G03090 dosa:Os12g0605800 hsa:56922 rno:294972 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.414

Rank 1 · TkA04G067200 · TK1151

Nucleus0.403

Rank 2 · TkA04G067200 · TK1151

Mitochondrion0.117

Rank 3 · TkA04G067200 · TK1151

Endoplasmic reticulum0.110

Rank 4 · TkA04G067200 · TK1151

Cell membrane0.109

Rank 5 · TkA04G067200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02785Biotin_carb_C2-15 aa

PF02785Biotin_carb_C15-56 aa

PF02785Biotin_carb_C57-93 aa

PF16668JLPA89-147 aa

PF02785Biotin_carb_C100-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G067200	`PF02785`	Biotin_carb_C	2	15	2.7e-12	47.5
TkA04G067200	`PF02785`	Biotin_carb_C	15	56	2.7e-12	47.5
TkA04G067200	`PF02785`	Biotin_carb_C	57	93	2.7e-12	47.5
TkA04G067200	`PF16668`	JLPA	89	147	0.082	12.7
TkA04G067200	`PF02785`	Biotin_carb_C	100	129	2.7e-12	47.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card