LXL04_036168 | RubberDandelionOmics

Gene overview

LXL04_036168

Reference: OH-1004 Chr: Chr08 Coordinates: 37472387-37473120 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

498 bp · LXL04_036168|LXL04_036168|OH1004|cDNA

ATGCATTATGACCCCATGATTGCCAAGCTTGTAGTATGGGGAGAAGAAGGGGACACTGTAAGCATGCATTATGACCCCATGATTGCCAAGCTTGTAGTATGGGGAGAAAATAGTGCTTGTgatttaatcaaattaaatgattCCTTATCAAAGTTTCAGAAAGTTGGTCATGGAAGCAATGAAAATGGAgGGTATATACGGTGTTTTGGAAGGATGCCAGCTGTAAAAGCTTCATCATCTTCTACTGATCCAATAACAGT...

CDS

Download CDS FASTA

498 bp · LXL04_036168|LXL04_036168|OH1004|CDS

ATGCATTATGACCCCATGATTGCCAAGCTTGTAGTATGGGGAGAAGAAGGGGACACTGTAAGCATGCATTATGACCCCATGATTGCCAAGCTTGTAGTATGGGGAGAAAATAGTGCTTGTGATTTAATCAAATTAAATGATTCCTTATCAAAGTTTCAGAAAGTTGGTCATGGAAGCAATGAAAATGGAGGGTATATACGGTGTTTTGGAAGGATGCCAGCTGTAAAAGCTTCATCATCTTCTACTGATCCAATAACAGT...

Protein

Download Protein FASTA

165 aa · LXL04_036168|LXL04_036168|OH1004|PROTEIN

MHYDPMIAKLVVWGEEGDTVSMHYDPMIAKLVVWGENSACDLIKLNDSLSKFQKVGHGSNENGGYIRCFGRMPAVKASSSSTDPITVGQMKILLGFLRSIINNLTPNPKLSAVFKSMNIQMPKTSTGSTSTVNQSSSSKSDQMQGKMTILPFLMFHLSYICYDRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036168`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036168

Location Chr08:37472387-37473120 (+)

Description Similar to MCCA: Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03090`	Biotin-attachment subunit of the 3-methylcrotonyl-CoA carboxylase, an enzyme that catalyzes the conversion of 3-methylcrotonyl-CoA to 3-methylglutaconyl-CoA, a critical step for leucine and isovaleric acid catabolism.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0605800`	Biotin-attachment subunit of the 3-methylcrotonyl-CoA carboxylase, an enzyme that catalyzes the conversion of 3-methylcrotonyl-CoA to 3-methylglutaconyl-CoA, a critical step for leucine and isovaleric acid catabolism.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036168 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006552 L-leucine catabolic process Biological Process

GO:0006768 biotin metabolic process Biological Process

GO:0009083 branched-chain amino acid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:1905202 methylcrotonoyl-CoA carboxylase complex Cellular Component

GO:0004075 biotin carboxylase activity Molecular Function

GO:0004485 methylcrotonoyl-CoA carboxylase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G03090

dosa:Os12g0605800

hsa:56922

rno:294972

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.302

Rank 1 · LXL04_036168 · OH-1004

Nucleus0.223

Rank 2 · LXL04_036168 · OH-1004

Cell membrane0.207

Rank 3 · LXL04_036168 · OH-1004

Extracellular0.184

Rank 4 · LXL04_036168 · OH-1004

Endoplasmic reticulum0.131

Rank 5 · LXL04_036168 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02785.26Biotin_carb_C15-57 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036168	`PF02785.26`	Biotin_carb_C	15	57	4.4e-12	46.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42523`	Arabidopsis thaliana	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	66.667%	Swiss-Prot	weak database homology
`Q2QMG2`	Oryza sativa subsp. japonica	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial	57.143%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card