TkA04G058210 | RubberDandelionOmics

Gene overview

TkA04G058210

Reference: TK1151 Chr: Chr04 Coordinates: 15511495-15513707 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1443 bp · TkA04G058210|TK1151|cDNA

AAATGGACCTCATTATCACCCGTTACAAAGATGGATCAAGTAATTAGTCGATCGATTCGAGATCGAGTATAGCAAAAGGCAAAAGCTACGATGAACGCACATATATTTATTAATCGTTTGAATTCCCACAAGAGCGCTTCTCGACGGGCCCAGATGAATGATCACCTGTTGCAATGGCGGGAATATTGAACTGATATGGGGATGTGTGGCGGGAAAATTGGCAGTTTAGACATGTTACCTTTCTTTTCACTTGCATCCCT...

CDS

Download CDS FASTA

861 bp · TkA04G058210|TK1151|CDS

ATGGGTAAAAGAACGGATACTTCGGTTCATGAGGAAGACATGGAAGTGGACGATGAACAACAGCAGCAAAATCAAGGCAACCCTTCATCGTTGTCCAATGATCAGAGCTTGTATGAGATTCTCGGGGTCGAAAGAACAGCATCTCAGCAGGAAATAAAGAAGGCATACCACAAATTGGCACTGCGATTACATCCTGATAAGAATCCCGATGACGAAGAAGCTAAAGAAAAATTCCAGCAACTGCAGAAAGTTGTATCGAT...

Protein

Download Protein FASTA

286 aa · TkA04G058210|TK1151|PROTEIN

MGKRTDTSVHEEDMEVDDEQQQQNQGNPSSLSNDQSLYEILGVERTASQQEIKKAYHKLALRLHPDKNPDDEEAKEKFQQLQKVVSILGDEEKRTLYDQTGCVDDAELAGDMAKNLKDYFRSMYKKVTETDIEEFEASYRGSESEKTDLINLYNKYKGHMNRLFCSMLCSDPKLDSHRFKDIIDKAISAGDVKSTKAYQNWAKQVSNTKPPTNPLISKKPKKETDDLYTIIAKRQSERKGRVDSMFSSLVSKYGGGKIGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G058210`
TK1151 ID	TkA04G058210
OH-1004 ID	LXL04_018418
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.700
Protein coverage (%)	TK1151 97.203 / OH-1004 74.866 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G058210

Location Chr04:15511495-15513707 (-)

Description Similar to ATJ6: Chaperone protein dnaJ 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06910`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018418 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006334 nucleosome assembly Biological Process

GO:0032781 positive regulation of ATP-dependent activity Biological Process

GO:0036205 histone catabolic process Biological Process

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0101031 protein folding chaperone complex Cellular Component

GO:0030544 Hsp70 protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G06910

dme:Dmel_CG6693

hsa:23234

mmu:108671

spo:2542992

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.574

Rank 1 · TkA04G058210 · TK1151

Cytoplasm0.462

Rank 2 · TkA04G058210 · TK1151

Cell membrane0.046

Rank 3 · TkA04G058210 · TK1151

Mitochondrion0.042

Rank 4 · TkA04G058210 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkA04G058210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226DnaJ37-98 aa

PF30912TIM141_C39-67 aa

PF23302HTH_DNAJC950-58 aa

PF18476PIN_873-78 aa

PF18476PIN_8113-160 aa

PF23302HTH_DNAJC9139-207 aa

PF18476PIN_8178-278 aa

PF00226DnaJ195-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G058210	`PF00226`	DnaJ	37	98	2.3e-26	92.4
TkA04G058210	`PF30912`	TIM141_C	39	67	0.11	13.3
TkA04G058210	`PF23302`	HTH_DNAJC9	50	58	1.9e-26	92.7
TkA04G058210	`PF18476`	PIN_8	73	78	0.0013	19.4
TkA04G058210	`PF18476`	PIN_8	113	160	0.0013	19.4
TkA04G058210	`PF23302`	HTH_DNAJC9	139	207	1.9e-26	92.7
TkA04G058210	`PF18476`	PIN_8	178	278	0.0013	19.4
TkA04G058210	`PF00226`	DnaJ	195	205	2.3e-26	92.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL54`	Arabidopsis thaliana	sp\|Q9FL54\|DNAJ6_ARATH Chaperone protein dnaJ 6	69.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card