TkA04G054710 | RubberDandelionOmics

Gene overview

TkA04G054710

Reference: TK1151 Chr: Chr04 Coordinates: 14621171-14623927 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2118 bp · TkA04G054710|TK1151|cDNA

TAACAACAAGAGCCTATATGTCTTTCCGCTAAACTTGAAGGAGAGAAAGAAATATAACACATTGTCAAAAAATGCTAAACCCAGAACCCTTGCTGATAGCCTCTCTAATGGCTTACAAGAGATTGCATTAGTACTCATAAACCCACAACGATGGCGACATTCAGAGCTCTCCAGCCAACAGAAACCATATGAATAACAAGATGGGTATTTGTTGATTTGACTGGAAACCACTTCATATCGTCAACAAAATCGATTCGCCC...

CDS

Download CDS FASTA

1323 bp · TkA04G054710|TK1151|CDS

ATGGGTTTGGAACCCTATGAATTTTCAACTTTTTTGCCTCGTAATTTGATGTTTCTGACTGACGATAATGTTTTGCTAGAAAACTATCATGTATTTTGTCAGTACGGCTTTCCTCCTAAAAGAATCGGAAAGATTTATAAAGAAGCCAAAGAAGTTTTCAGATATAATCACGGGGTTTTATCATCGCGACTTCATGAAATTCAAAAAAACGTTCTTGATCAATCCACTGTTATCAAGATAGTCGGTTCATGTCCTTCTCT...

Protein

Download Protein FASTA

440 aa · TkA04G054710|TK1151|PROTEIN

MGLEPYEFSTFLPRNLMFLTDDNVLLENYHVFCQYGFPPKRIGKIYKEAKEVFRYNHGVLSSRLHEIQKNVLDQSTVIKIVGSCPSLLILDDNHDLLKFIKELKSFGITNSWFTNHLSEENSYDWRQILEILRLFKKLGCENEQLGRLIDQHPTILLKNSGTTSVLIIGFLIKFGATKSNILSFFINFPKIEVEECYSNLKRSYHFLLKIEMEVENIANLFCTHPYLLGSWSLKGVKTALNSLNLGKRRLCEIIIKNPQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G054710`
TK1151 ID	TkA04G054710
OH-1004 ID	LXL04_036328
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 74.957 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G054710`
Location	Chr04:14621171-14623927 (+)
Description	Similar to MTERF18: Transcription termination factor MTEF18, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036328` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation Biological Process GO:0006353 DNA-templated transcription termination Biological Process GO:0007005 mitochondrion organization Biological Process GO:0008380 RNA splicing Biological Process GO:0009658 chloroplast organization Biological Process GO:0009733 response to auxin Biological Process GO:0009735 response to cytokinin Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009739 response to gibberellin Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference	ath:AT1G74120 ath:AT3G60400 dosa:Os05g0404000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.545

Rank 1 · TkA04G054710 · TK1151

Plastid0.280

Rank 2 · TkA04G054710 · TK1151

Nucleus0.075

Rank 3 · TkA04G054710 · TK1151

Cytoplasm0.053

Rank 4 · TkA04G054710 · TK1151

Cell membrane0.013

Rank 5 · TkA04G054710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02536mTERF21-110 aa

PF11186DUF297280-102 aa

PF02536mTERF132-295 aa

PF11186DUF2972186-355 aa

PF17660BTRD1310-325 aa

PF00598Flu_M1310-357 aa

PF02536mTERF312-412 aa

PF09288UBA_3315-335 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G054710	`PF02536`	mTERF	21	110	2.8e-37	129.0
TkA04G054710	`PF11186`	DUF2972	80	102	0.052	14.2
TkA04G054710	`PF02536`	mTERF	132	295	2.8e-37	129.0
TkA04G054710	`PF11186`	DUF2972	186	355	0.052	14.2
TkA04G054710	`PF17660`	BTRD1	310	325	0.0046	17.6
TkA04G054710	`PF00598`	Flu_M1	310	357	0.078	13.2
TkA04G054710	`PF02536`	mTERF	312	412	2.8e-37	129.0
TkA04G054710	`PF09288`	UBA_3	315	335	0.2	12.2
TkA04G054710	`PF17660`	BTRD1	358	372	0.0046	17.6
TkA04G054710	`PF00598`	Flu_M1	380	411	0.078	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card