LXL04_036328 | RubberDandelionOmics

Gene overview

LXL04_036328

Reference: OH-1004 Chr: Chr08 Coordinates: 40119131-40120894 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1764 bp · LXL04_036328|LXL04_036328|OH1004|cDNA

ATGTATTGTATCCAGAATCTCAAAAAATCATCTTTCCTCAGATGggtatttgttgatttgactGGAAACCACTTCATATCGTCAACAAAATCGATTCGCCCAAATGGGCATTACCATACGACCCAAAACCCTAGGTTTTATAGCACAAAAGCCGCTTATAAGACCAAAACCAGTCAAAATTTAAACGAGTTGTTACTCGATGATGGAAATGGCGGTTTATGGTCTCGTACAGCCTGTCGACAAGCTCAAGATGCTTTGTT...

CDS

Download CDS FASTA

1764 bp · LXL04_036328|LXL04_036328|OH1004|CDS

ATGTATTGTATCCAGAATCTCAAAAAATCATCTTTCCTCAGATGGGTATTTGTTGATTTGACTGGAAACCACTTCATATCGTCAACAAAATCGATTCGCCCAAATGGGCATTACCATACGACCCAAAACCCTAGGTTTTATAGCACAAAAGCCGCTTATAAGACCAAAACCAGTCAAAATTTAAACGAGTTGTTACTCGATGATGGAAATGGCGGTTTATGGTCTCGTACAGCCTGTCGACAAGCTCAAGATGCTTTGTT...

Protein

Download Protein FASTA

587 aa · LXL04_036328|LXL04_036328|OH1004|PROTEIN

MYCIQNLKKSSFLRWVFVDLTGNHFISSTKSIRPNGHYHTTQNPRFYSTKAAYKTKTSQNLNELLLDDGNGGLWSRTACRQAQDALLDYLHSTRSLQFVDAENISRNSPKFLGKLLKGAENKENAGQFVTRYLRYHPINEFEPFFESMGLEPYEFSTFLPRNLMFLTDDNVLLENYHVFCQYGFPPKRIGKIYKEAKEVFRYNHGVLSSRLHEIQKNVLDQSTVIKIVGSCPSLLILDDNHDLLKFIKELKSFGITNSWF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036328`
TK1151 ID	TkA04G054710
OH-1004 ID	LXL04_036328
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 74.957 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036328

Location Chr08:40119131-40120894 (-)

Description Similar to MTERF18: Transcription termination factor MTEF18, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60400`	Transcription termination factor involved in the regulation of mitochondrial-encoded gene expression.	Mutations in an Arabidopsis mitochondrial transcription termination factor-related protein enhance thermotolerance in the absence of the major molecular chaperone HSP101.2012 · DOI: 10.1105/tpc.112.101006
`At1g74120`	Transcription termination factor required for mitochondrial NAD2 intron 3 splicing and normal membrane respiratory chain Complex I activity.	Arabidopsis mTERF15 is required for mitochondrial nad2 intron 3 splicing and functional complex I activity.2014 · DOI: 10.1371/journal.pone.0112360

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0404000`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036328 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G74120

ath:AT3G60400

dosa:Os05g0404000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.794

Rank 1 · LXL04_036328 · OH-1004

Plastid0.115

Rank 2 · LXL04_036328 · OH-1004

Nucleus0.057

Rank 3 · LXL04_036328 · OH-1004

Cytoplasm0.038

Rank 4 · LXL04_036328 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_036328 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02536.20mTERF167-257 aa

PF02536.20mTERF279-442 aa

PF02536.20mTERF459-559 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036328	`PF02536.20`	mTERF	167	257	8.1e-37	127.5
LXL04_036328	`PF02536.20`	mTERF	279	442	8.1e-37	127.5
LXL04_036328	`PF02536.20`	mTERF	459	559	8.1e-37	127.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M219`	Arabidopsis thaliana	Transcription termination factor MTEF18, mitochondrial	30.769%	Swiss-Prot	moderate database homology
`Q9C6A1`	Arabidopsis thaliana	Transcription termination factor MTERF15, mitochondrial	21.040%	Swiss-Prot	weak database homology
`Q6AUK6`	Oryza sativa subsp. japonica	Transcription termination factor MTERF4, chloroplastic	22.442%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card