TkA04G042160 | RubberDandelionOmics

Gene overview

TkA04G042160

Reference: TK1151 Chr: Chr04 Coordinates: 11297270-11303911 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3586 bp · TkA04G042160|TK1151|cDNA

ATTCACGACCGAGTCCAGGTGTCCCGTTTCACTCACCGCCGACAATGCTCGCGTCTTCCGCAAGTCTCAATCACAATTTCCACCCCAAAATGTCGTCGCCGACCACCGAAATGGGGACAACCTCCATCGCAGTCATCAATCATGTCACCATGTGCTTTCAATTAGGCGCTATGCCTTTTTCAAAAAGCTACATTCGACGTGGGTCCCCAATTAGCTGGATGATAAGGCAAACCCTCGTTTTCTTTCTTCTTTTTATGATT...

CDS

Download CDS FASTA

492 bp · TkA04G042160|TK1151|CDS

ATGAAAATGGGATCCAACAAAATCGCTGATTTGGAACTTCAGGGTGCAGGATCAAAGCTCGGCCTAGAAATCTGGTGTATAGAAAACCTCCGTTTAGTTTCAGTCCCCCAATCTTCACATGGAAAATTCTTCTCAGGAAGTGCATATTTAGTCCTCCATACAACTTTGCTAAAAAGCGGTGCCCTTCAACACGACATACATTATTGGCTAGGAACCGATGCTAATGAGGTTGACTCAACTTTAGCATCGGATAAAGCCCT...

Protein

Download Protein FASTA

163 aa · TkA04G042160|TK1151|PROTEIN

MKMGSNKIADLELQGAGSKLGLEIWCIENLRLVSVPQSSHGKFFSGSAYLVLHTTLLKSGALQHDIHYWLGTDANEVDSTLASDKALELDAALGSQSVQYKEVQGQETGKFLSYFKPCIIPLEGVYYSGQNQSSKSPNYETRLLTCKGDRVVHVKKWRFPDLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G042160`
TK1151 ID	TkA04G042160
OH-1004 ID	LXL04_036544
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 96.319 / OH-1004 17.065 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G042160

Location Chr04:11297270-11303911 (-)

Description Similar to VLN1: Villin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29890`	Binds actin and actin bundles independently of Ca²⁺/calmodulin, but lacks filament-severing, capping and nucleation activities in vitro.	Arabidopsis VILLIN1 generates actin filament cables that are resistant to depolymerization.2005 · DOI: 10.1105/tpc.104.028555 Arabidopsis VILLIN1 and VILLIN3 have overlapping and distinct activities in actin bundle formation and turnover.2010 · DOI: 10.1105/tpc.110.076240
`At5g57320`	Major actin filament stabilizing factor and regulator of actin dynamics.	Arabidopsis VILLIN5, an actin filament bundling and severing protein, is necessary for normal pollen tube growth.2010 · DOI: 10.1105/tpc.110.076257 Arabidopsis villins promote actin turnover at pollen tube tips and facilitate the construction of actin collars.2013 · DOI: 10.1105/tpc.113.110940
`At3g57410`	Binds actin and actin bundles independently of Ca²⁺, but severs actin filaments in a calcium-dependent manner.	Arabidopsis VILLIN1 and VILLIN3 have overlapping and distinct activities in actin bundle formation and turnover.2010 · DOI: 10.1105/tpc.110.076240 Arabidopsis VILLIN2 and VILLIN3 are required for the generation of thick actin filament bundles and for directional organ growth.2012 · DOI: 10.1104/pp.111.192385 Arabidopsis VILLIN2 and VILLIN3 act redundantly in sclerenchyma development via bundling of actin filaments.2012 · DOI: 10.1111/j.1365-313x.2012.05044.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0240800`	Ca(2+)-regulated actin-binding protein (By similarity).	No verified direct reference in this release
`Os06g0659300`	Ca(2+)-regulated actin-binding protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036544 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0030042 actin filament depolymerization Biological Process

GO:0030835 negative regulation of actin filament depolymerization Biological Process

GO:0048767 root hair elongation Biological Process

GO:0051014 actin filament severing Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0051693 actin filament capping Biological Process

GO:0051764 actin crosslink formation Biological Process

GO:0099636 cytoplasmic streaming Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G29890

ath:AT4G30160

ath:AT5G57320

dosa:Os06g0659300

dosa:Os08g0240800

osa:4341731

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.685

Rank 1 · TkA04G042160 · TK1151

Nucleus0.263

Rank 2 · TkA04G042160 · TK1151

Cell membrane0.081

Rank 3 · TkA04G042160 · TK1151

Endoplasmic reticulum0.063

Rank 4 · TkA04G042160 · TK1151

Mitochondrion0.059

Rank 5 · TkA04G042160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00626Gelsolin32-111 aa

PF25480DUF790433-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G042160	`PF00626`	Gelsolin	32	111	8.8e-12	45.4
TkA04G042160	`PF25480`	DUF7904	33	113	1.2e-05	25.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81643`	Arabidopsis thaliana	sp\|O81643\|VILI1_ARATH Villin-1	62.300%	Swiss-Prot	High
`Q9LVC6`	Arabidopsis thaliana	sp\|Q9LVC6\|VILI5_ARATH Villin-5	57.300%	Swiss-Prot	High
`O81645`	Arabidopsis thaliana	sp\|O81645\|VILI3_ARATH Villin-3	53.800%	Swiss-Prot	High
`Q0J716`	Oryza sativa subsp. japonica	sp\|Q0J716\|VLN5_ORYSJ Villin-5	53.200%	Swiss-Prot	High
`Q67U26`	Oryza sativa subsp. japonica	sp\|Q67U26\|VLN3_ORYSJ Villin-3	53.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card