LXL04_036544 | RubberDandelionOmics

Gene overview

LXL04_036544

Reference: OH-1004 Chr: Chr08 Coordinates: 44231380-44235821 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2763 bp · LXL04_036544|LXL04_036544|OH1004|cDNA

ATGGGATCCAACAAAATCGCTGATTTGAAACTTCAGGGTGCAGGATCAAAGCTCGGCCTAGAAATCTGGTCTATAGAAAACCTCCGTTTAGTTTCAGTCCCCCAATCTTCACATGGAAAATTCTTTTCAGGAAGTGCATATTTGGTCCTCCATACAACTTTGCTAAAAAGCGGCGCTCTTCAACACGACATACATTATTGGCTAGGAACCGATGCTAATGAGGTTGACTCAACTTTAGCATCGGATAAAGCCCTAGAATT...

CDS

Download CDS FASTA

2763 bp · LXL04_036544|LXL04_036544|OH1004|CDS

ATGGGATCCAACAAAATCGCTGATTTGAAACTTCAGGGTGCAGGATCAAAGCTCGGCCTAGAAATCTGGTCTATAGAAAACCTCCGTTTAGTTTCAGTCCCCCAATCTTCACATGGAAAATTCTTTTCAGGAAGTGCATATTTGGTCCTCCATACAACTTTGCTAAAAAGCGGCGCTCTTCAACACGACATACATTATTGGCTAGGAACCGATGCTAATGAGGTTGACTCAACTTTAGCATCGGATAAAGCCCTAGAATT...

Protein

Download Protein FASTA

920 aa · LXL04_036544|LXL04_036544|OH1004|PROTEIN

MGSNKIADLKLQGAGSKLGLEIWSIENLRLVSVPQSSHGKFFSGSAYLVLHTTLLKSGALQHDIHYWLGTDANEVDSTLASDKALELDAALGSQSVQYKEVQGQETGKFLSYFKPCIIPLEGVYYSGQIQSSKSPNYETRLLTCKGDRVVHVREVAFSRSSLNHRDVFILDTESKIFHFSGCNSSIQERAKALEVVQYIKEYKHKGNCDVAAIEDGKFVGDAEVGEFWNFFGGYAPIPKDPPSTNEQPENLAAKLFWITL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036544`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036544

Location Chr08:44231380-44235821 (+)

Description Similar to VLN1: Villin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29890`	Binds actin and actin bundles independently of Ca²⁺/calmodulin, but lacks filament-severing, capping and nucleation activities in vitro.	Arabidopsis VILLIN1 generates actin filament cables that are resistant to depolymerization.2005 · DOI: 10.1105/tpc.104.028555 Arabidopsis VILLIN1 and VILLIN3 have overlapping and distinct activities in actin bundle formation and turnover.2010 · DOI: 10.1105/tpc.110.076240
`At5g57320`	Major actin filament stabilizing factor and regulator of actin dynamics.	Arabidopsis VILLIN5, an actin filament bundling and severing protein, is necessary for normal pollen tube growth.2010 · DOI: 10.1105/tpc.110.076257 Arabidopsis villins promote actin turnover at pollen tube tips and facilitate the construction of actin collars.2013 · DOI: 10.1105/tpc.113.110940
`At4g30160`	Binds actin and actin bundles independently of Ca²⁺, but caps filament barbed ends and severs filaments in a calcium-dependent manner.	Arabidopsis VILLIN4 is involved in root hair growth through regulating actin organization in a Ca2+-dependent manner.2011 · DOI: 10.1111/j.1469-8137.2010.03632.x The universal bundling activity of AtVLN4 in diffusely growing cells.2011 · DOI: 10.4161/psb.6.9.16501

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0659300`	Ca(2+)-regulated actin-binding protein.	No verified direct reference in this release
`Os08g0240800`	Ca(2+)-regulated actin-binding protein (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036544 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0030042 actin filament depolymerization Biological Process

GO:0030835 negative regulation of actin filament depolymerization Biological Process

GO:0048767 root hair elongation Biological Process

GO:0051014 actin filament severing Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0051693 actin filament capping Biological Process

GO:0051764 actin crosslink formation Biological Process

GO:0099636 cytoplasmic streaming Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G29890

ath:AT4G30160

ath:AT5G57320

dosa:Os06g0659300

dosa:Os08g0240800

osa:4341731

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.697

Rank 1 · LXL04_036544 · OH-1004

Nucleus0.204

Rank 2 · LXL04_036544 · OH-1004

Cell membrane0.156

Rank 3 · LXL04_036544 · OH-1004

Golgi apparatus0.069

Rank 4 · LXL04_036544 · OH-1004

Endoplasmic reticulum0.054

Rank 5 · LXL04_036544 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00626.28Gelsolin30-109 aa

PF25480.2DUF790431-111 aa

PF00626.28Gelsolin150-200 aa

PF00626.28Gelsolin269-338 aa

PF25480.2DUF7904396-480 aa

PF00626.28Gelsolin639-677 aa

PF02209.25VHP885-920 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036544	`PF00626.28`	Gelsolin	30	109	6.8e-49	164.3
LXL04_036544	`PF25480.2`	DUF7904	31	111	4.8e-18	65.5
LXL04_036544	`PF00626.28`	Gelsolin	150	200	6.8e-49	164.3
LXL04_036544	`PF00626.28`	Gelsolin	269	338	6.8e-49	164.3
LXL04_036544	`PF25480.2`	DUF7904	396	480	4.8e-18	65.5
LXL04_036544	`PF00626.28`	Gelsolin	639	677	6.8e-49	164.3
LXL04_036544	`PF02209.25`	VHP	885	920	2.8e-13	50.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81643`	Arabidopsis thaliana	Villin-1	52.278%	Swiss-Prot	strong database homology
`Q9LVC6`	Arabidopsis thaliana	Villin-5	46.528%	Swiss-Prot	moderate database homology
`O65570`	Arabidopsis thaliana	Villin-4	46.447%	Swiss-Prot	moderate database homology
`Q67U26`	Oryza sativa subsp. japonica	Villin-3	45.324%	Swiss-Prot	moderate database homology
`Q0J716`	Oryza sativa subsp. japonica	Villin-5	45.723%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card