Gene Card
Gene overview
cDNA / CDS / Protein Sequences
834 bp · TkA04G042100|TK1151|cDNA
ATGGGTGCTTTAATCGAAGGACCACGGGTCGGGCGGTTCGATGCTTTCGGGAAGCCTGTTCAAATGCGTGGACACAACGCGACTCTAGTGGTGCTCGGGACATTCTTGTTATGGTTCGGATGGTTTGGGTTTAACCCCGGGTCGTTCAACAAGATTCTTGTATCCTATCCCGATAGTTTTGATCAAGGGAACTGGACCGCGGTAGGCCGAACCGCGGTTACAACGACGCTAGCTGGGTCGACAGCTGGGATTGTAACCTT...
834 bp · TkA04G042100|TK1151|CDS
ATGGGTGCTTTAATCGAAGGACCACGGGTCGGGCGGTTCGATGCTTTCGGGAAGCCTGTTCAAATGCGTGGACACAACGCGACTCTAGTGGTGCTCGGGACATTCTTGTTATGGTTCGGATGGTTTGGGTTTAACCCCGGGTCGTTCAACAAGATTCTTGTATCCTATCCCGATAGTTTTGATCAAGGGAACTGGACCGCGGTAGGCCGAACCGCGGTTACAACGACGCTAGCTGGGTCGACAGCTGGGATTGTAACCTT...
Protein
Download Protein FASTA277 aa · TkA04G042100|TK1151|PROTEIN
MGALIEGPRVGRFDAFGKPVQMRGHNATLVVLGTFLLWFGWFGFNPGSFNKILVSYPDSFDQGNWTAVGRTAVTTTLAGSTAGIVTLFGRRLLVGHWDALDVCNGVLGGFVAITSGCSVVEPWAAIVCGFFAACVLIGLNIVALKLHYDDPLEAAQLHGGCGAWGLIFTGLFAKEEFVIQTYNSGNLGVTRPYGLLLGGGWGLIGAQVVEVLAVVGWVSITMGSLFYLLHWLRILRISSDEEVAGLDISSHGGYAYNAHH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G042100 |
|---|---|
| TK1151 ID | TkA04G042100 |
| OH-1004 ID | LXL04_036545 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 99.639 / OH-1004 28.279Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G042100 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:11281778-11282611 (-) | |||||||||
| Description | Similar to NPC1: Non-specific phospholipase C1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009395 phospholipid catabolic process Biological Process GO:0009413 response to flooding Biological Process GO:0010311 lateral root formation Biological Process GO:0042742 defense response to bacterium Biological Process GO:0048229 gametophyte development Biological Process GO:0048364 root development Biological Process GO:0051258 protein polymerization Biological Process GO:0072488 ammonium transmembrane transport Biological Process GO:0080181 lateral root branching Biological Process GO:0097272 ammonium homeostasis Biological Process GO:0000137 Golgi cis cisterna Cellular Component GO:0005576 extracellular region Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G07230 ath:AT2G26870 ath:AT4G13510 sly:543590 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00909Ammonium_transp2-256 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G042100 | PF00909 | Ammonium_transp | 2 | 256 | 2.9e-68 | 231.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.