LXL04_036545 | RubberDandelionOmics

Gene overview

LXL04_036545

Reference: OH-1004 Chr: Chr08 Coordinates: 44248116-44251636 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2931 bp · LXL04_036545|LXL04_036545|OH1004|cDNA

ATGAACCGCCGGCGACTCTCATTGACCGTTTTCCTCCTCATCCATATGCTAGCCTTTACTCAGTCGCAGAATTCTTTCCCTTTTGGTAAAAAGTCTCACGAAATCGACGGACCCATCAAAACCCTAGTCGTCTTAGTAATGGAAAATCGTTCCTTTGATCACGTATTGGGCTGGATCAAGAAAATCCGCCCCGACATCGATGGGGTCACCGGCGAAGAGCATAATCATGTCAACGCCTCCGACCCTGCGTCTAGTAAAAT...

CDS

Download CDS FASTA

2931 bp · LXL04_036545|LXL04_036545|OH1004|CDS

ATGAACCGCCGGCGACTCTCATTGACCGTTTTCCTCCTCATCCATATGCTAGCCTTTACTCAGTCGCAGAATTCTTTCCCTTTTGGTAAAAAGTCTCACGAAATCGACGGACCCATCAAAACCCTAGTCGTCTTAGTAATGGAAAATCGTTCCTTTGATCACGTATTGGGCTGGATCAAGAAAATCCGCCCCGACATCGATGGGGTCACCGGCGAAGAGCATAATCATGTCAACGCCTCCGACCCTGCGTCTAGTAAAAT...

Protein

Download Protein FASTA

976 aa · LXL04_036545|LXL04_036545|OH1004|PROTEIN

MNRRRLSLTVFLLIHMLAFTQSQNSFPFGKKSHEIDGPIKTLVVLVMENRSFDHVLGWIKKIRPDIDGVTGEEHNHVNASDPASSKIYVSDEAVFVDSDPGHSIQAIREQIFGSNVTYSNPAPMNGFVQQANGMGVDGLDRTVMSGFKPELLPTYTELVNEFAVFDRWFASVPASTQPNRFYVHSATSHGASSNVRKDLIHGFPQKTIFDSLDDNDLTFGIYYQNIPATLFFKSLRKLKYITKFHDYDLMFKYHAKKGKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036545`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036545

Location Chr08:44248116-44251636 (+)

Description Similar to NPC1: Non-specific phospholipase C1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07230`	Non-specific phospholipase C1.	No verified direct reference in this release
`At2g26870`	Non-specific phospholipase C2.	No verified direct reference in this release
`At4g13510`	High affinity ammonium transporter probably involved in ammonium uptake from the soil, long-distance transport to the shoots and re-uptake of apoplastic ammonium that derives from photorespiration in shoots.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036545 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009395 phospholipid catabolic process Biological Process

GO:0009413 response to flooding Biological Process

GO:0010311 lateral root formation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0048229 gametophyte development Biological Process

GO:0048364 root development Biological Process

GO:0051258 protein polymerization Biological Process

GO:0072488 ammonium transmembrane transport Biological Process

GO:0080181 lateral root branching Biological Process

GO:0097272 ammonium homeostasis Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G07230

ath:AT2G26870

ath:AT4G13510

sly:543590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.431

Rank 1 · LXL04_036545 · OH-1004

Cell membrane0.319

Rank 2 · LXL04_036545 · OH-1004

Cytoplasm0.166

Rank 3 · LXL04_036545 · OH-1004

Endoplasmic reticulum0.142

Rank 4 · LXL04_036545 · OH-1004

Golgi apparatus0.095

Rank 5 · LXL04_036545 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04185.20Phosphoesterase39-398 aa

PF00909.27Ammonium_transp529-955 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036545	`PF04185.20`	Phosphoesterase	39	398	5.9e-105	352.0
LXL04_036545	`PF00909.27`	Ammonium_transp	529	955	3.4e-125	418.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7Y9`	Arabidopsis thaliana	Non-specific phospholipase C1	71.673%	Swiss-Prot	moderate database homology
`O81020`	Arabidopsis thaliana	Non-specific phospholipase C2	59.885%	Swiss-Prot	moderate database homology
`P54144`	Arabidopsis thaliana	Ammonium transporter 1 member 1	69.977%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card