TkA04G037480 | RubberDandelionOmics

Gene overview

TkA04G037480

Reference: TK1151 Chr: Chr04 Coordinates: 10049629-10057375 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2306 bp · TkA04G037480|TK1151|cDNA

TCTATCTTAACTTCTTGTTTATTAAACTCCAATTTTGCCACGTTGCAGAAGCTTATTGGTACAAATACTACCTTAGGCTACACTGTTCTTCAGTTCCATGATCTGCCTACCAATGATAACTGGTACTGGATTGGAGTTGGTGCCTTGTTACTCTACGCTGTCGTTTTCAACATCATAGTCACTCTCAGTTTGGCTTATCTTAATCCTCTAAAAAACGCACAGATAGTTCCACCTGATGCCGGCGATCAAACACCATCTTC...

CDS

Download CDS FASTA

4248 bp · TkA04G037480|TK1151|CDS

ATGGCAGCGTCAGATGGCACCGAGTACTTCGACGTGGATATCGAGAGCGGTCATGATACGTTTTCACGGCGGTCAAATACTGAGGAGGCTCAACGAGACGAGACGGCGCTTCTATGGGCGGCGATCGAGCGGTTACCGTCGAGAAAGGAGAAGAAATTTGCGTTACTGAAACGTTCAGCCTCCGGATCAAATGGCTCTGAGGAGAGAACGGAAACAGTAGACGTTACGAAGCTTGATCGGCGTAACCGCTCACTTATCGT...

Protein

Download Protein FASTA

1415 aa · TkA04G037480|TK1151|PROTEIN

MAASDGTEYFDVDIESGHDTFSRRSNTEEAQRDETALLWAAIERLPSRKEKKFALLKRSASGSNGSEERTETVDVTKLDRRNRSLIVRKALATSEQDNYKLLAAIKERFDRVGLEVPKVEVRFEKLNIEADVVIGSRALPTLINYSRDVIEQFLTNLRIFHPRRHRLSILKDISGSIKPGRMTLLLGPPGSGKSTLLLALAGKLDSSLKKSGKITYNGHELHEFCVQRTSAYISQTDNHIAELTVRETLDFGARCEGEGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G037480`
TK1151 ID	TkA04G037480
OH-1004 ID	LXL04_036552
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G037480

Location Chr04:10049629-10057375 (-)

Description Similar to ABCG31: ABC transporter G family member 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29940`	Together with ABCG25, export abscisic acid (ABA) from the endosperm to deliver it to the embryo via ABCG30 and ABCG40-mediated import to suppress radicle extension and subsequent embryonic growth.	The role of Arabidopsis ABCG9 and ABCG31 ATP binding cassette transporters in pollen fitness and the deposition of steryl glycosides on the pollen coat.2014 · DOI: 10.1105/tpc.113.118935 Abscisic acid transporters cooperate to control seed germination.2015 · DOI: 10.1038/ncomms9113
`At1g15210`	May be a general defense protein.	No verified direct reference in this release
`At1g59870`	Together with ABCG37, regulates auxin homeostasis and responses by playing a dual role in coumarin (e.g. esculin) and in the auxin precursor indole 3-butyric acid (IBA) efflux transport, thus influencing cotyledons, roots and root hairs development.	Loss of AtPDR8, a plasma membrane ABC transporter of Arabidopsis thaliana, causes hypersensitive cell death upon pathogen infection.2006 · DOI: 10.1093/pcp/pcj001 Arabidopsis PEN3/PDR8, an ATP binding cassette transporter, contributes to nonhost resistance to inappropriate pathogens that enter by direct penetration.2006 · DOI: 10.1105/tpc.105.038372 The ABC transporter AtPDR8 is a cadmium extrusion pump conferring heavy metal resistance.2007 · DOI: 10.1111/j.1365-313x.2007.03044.x Extracellular transport and integration of plant secretory proteins into pathogen-induced cell wall compartments.2009 · DOI: 10.1111/j.1365-313x.2008.03743.x Glucosinolate metabolites required for an Arabidopsis innate immune response.2009 · DOI: 10.1126/science.1164627 The Arabidopsis PLEIOTROPIC DRUG RESISTANCE8/ABCG36 ATP binding cassette transporter modulates sensitivity to the auxin precursor indole-3-butyric acid.2009 · DOI: 10.1105/tpc.109.065821 Overexpression of AtABCG36 improves drought and salt stress resistance in Arabidopsis.2010 · DOI: 10.1111/j.1399-3054.2010.01353.x Arabidopsis PIS1 encodes the ABCG37 transporter of auxinic compounds including the auxin precursor indole-3-butyric acid.2010 · DOI: 10.1073/pnas.1005878107 Induction and suppression of PEN3 focal accumulation during Pseudomonas syringae pv. tomato DC3000 infection of Arabidopsis.2013 · DOI: 10.1094/mpmi-11-12-0262-r Role of the penetration-resistance genes PEN1, PEN2 and PEN3 in the hypersensitive response and race-specific resistance in Arabidopsis thaliana.2014 · DOI: 10.1111/tpj.12571 Mutant Allele-Specific Uncoupling of PENETRATION3 Functions Reveals Engagement of the ATP-Binding Cassette Transporter in Distinct Tryptophan Metabolic Pathways.2015 · DOI: 10.1104/pp.15.00182 ABC transporter PEN3/PDR8/ABCG36 interacts with calmodulin that, like PEN3, is required for Arabidopsis nonhost resistance.2016 · DOI: 10.1111/nph.13582 An Arabidopsis Lipid Flippase Is Required for Timely Recruitment of Defenses to the Host-Pathogen Interface at the Plant Cell Surface.2017 · DOI: 10.1016/j.molp.2017.04.003 Arabidopsis Transporter ABCG37/PDR9 contributes primarily highly oxygenated Coumarins to Root Exudation.2017 · DOI: 10.1038/s41598-017-03250-6 Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation.2018 · DOI: 10.1007/s10265-017-0979-4 Arabidopsis BTB/POZ protein-dependent PENETRATION3 trafficking and disease susceptibility.2017 · DOI: 10.1038/s41477-017-0039-z
`At3g16340`	May be a general defense protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0205500`	May be a general defense protein.	No verified direct reference in this release
`UniProt: A2WSH0`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036552 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009914 hormone transport Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010496 intercellular transport Biological Process

GO:0048581 negative regulation of post-embryonic development Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0080168 abscisic acid transport Biological Process

GO:0140352 export from cell Biological Process

GO:1901656 glycoside transport Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT2G29940

dosa:Os06g0554800

dosa:Os10g0205500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.531

Rank 1 · TkA04G037480 · TK1151

Endoplasmic reticulum0.186

Rank 2 · TkA04G037480 · TK1151

Lysosome / Vacuole0.157

Rank 3 · TkA04G037480 · TK1151

Cytoplasm0.118

Rank 4 · TkA04G037480 · TK1151

Golgi apparatus0.092

Rank 5 · TkA04G037480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13304AAA_218-63 aa

PF14510ABC_trans_N94-144 aa

PF03193RsgA_GTPase159-209 aa

PF25199nSTAND_NTPase5163-205 aa

PF13191AAA_16164-207 aa

PF00005ABC_tran170-350 aa

PF09818ABC_ATPase170-202 aa

PF20703nSTAND1170-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G037480	`PF13304`	AAA_21	8	63	1.6e-10	42.2
TkA04G037480	`PF14510`	ABC_trans_N	94	144	4.4e-06	27.7
TkA04G037480	`PF03193`	RsgA_GTPase	159	209	4.1e-07	30.7
TkA04G037480	`PF25199`	nSTAND_NTPase5	163	205	9e-05	23.1
TkA04G037480	`PF13191`	AAA_16	164	207	1.4e-05	26.4
TkA04G037480	`PF00005`	ABC_tran	170	350	2.2e-42	145.6
TkA04G037480	`PF09818`	ABC_ATPase	170	202	0.013	15.3
TkA04G037480	`PF20703`	nSTAND1	170	199	0.24	11.7
TkA04G037480	`PF02367`	TsaE	171	206	0.025	15.2
TkA04G037480	`PF13481`	AAA_25	173	201	7.5e-07	29.7
TkA04G037480	`PF13086`	AAA_11	173	205	0.13	12.7
TkA04G037480	`PF13175`	AAA_15	176	209	0.27	11.5
TkA04G037480	`PF13555`	AAA_29	178	201	6.3e-07	29.8
TkA04G037480	`PF03215`	Rad17	179	210	0.0049	17.5
TkA04G037480	`PF06068`	TIP49	179	247	0.23	11.3
TkA04G037480	`PF00437`	T2SSE	179	207	1.8	7.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7PC88`	Arabidopsis thaliana	sp\|Q7PC88\|AB31G_ARATH ABC transporter G family member 31	69.500%	Swiss-Prot	High
`Q7PC86`	Arabidopsis thaliana	sp\|Q7PC86\|AB35G_ARATH ABC transporter G family member 35	55.100%	Swiss-Prot	High
`Q9XIE2`	Arabidopsis thaliana	sp\|Q9XIE2\|AB36G_ARATH ABC transporter G family member 36	54.200%	Swiss-Prot	High
`Q94A18`	Arabidopsis thaliana	sp\|Q94A18\|AB29G_ARATH ABC transporter G family member 29	55.900%	Swiss-Prot	High
`Q8S628`	Oryza sativa subsp. japonica	sp\|Q8S628\|AB51G_ORYSJ ABC transporter G family member 51	62.800%	Swiss-Prot	High
`A2WSH0`	Oryza sativa subsp. indica	sp\|A2WSH0\|AB36G_ORYSI ABC transporter G family member 36	56.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card