LXL04_036552 | RubberDandelionOmics

Gene overview

LXL04_036552

Reference: OH-1004 Chr: Chr08 Coordinates: 44347002-44354486 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4248 bp · LXL04_036552|LXL04_036552|OH1004|cDNA

ATGGCAGCGTCAGATGGCACCGAGTACTTCGACGTGGATATCGAGAGCGGTCATGATACGTTTTCACGGCGGTCAAATACTGAGGAGGCTCAACGAGACGAGACGGCGCTTCTATGGGCGGCGATCGAGCGGTTACCGTCGAGAAAGGAGAAGAAATTTGCGTTACTGAAACGTTCAGCCTCCGGATCAAATGGCTCTGAGGAGAGAACGGAAACAGTAGACGTTACGAAGCTTGATCGGCGTAACCGCTCACTTATCGT...

CDS

Download CDS FASTA

4248 bp · LXL04_036552|LXL04_036552|OH1004|CDS

ATGGCAGCGTCAGATGGCACCGAGTACTTCGACGTGGATATCGAGAGCGGTCATGATACGTTTTCACGGCGGTCAAATACTGAGGAGGCTCAACGAGACGAGACGGCGCTTCTATGGGCGGCGATCGAGCGGTTACCGTCGAGAAAGGAGAAGAAATTTGCGTTACTGAAACGTTCAGCCTCCGGATCAAATGGCTCTGAGGAGAGAACGGAAACAGTAGACGTTACGAAGCTTGATCGGCGTAACCGCTCACTTATCGT...

Protein

Download Protein FASTA

1415 aa · LXL04_036552|LXL04_036552|OH1004|PROTEIN

MAASDGTEYFDVDIESGHDTFSRRSNTEEAQRDETALLWAAIERLPSRKEKKFALLKRSASGSNGSEERTETVDVTKLDRRNRSLIVRKALATSEQDNYKLLAAIKERFDRVGLEVPKVEVRFEKLNIEADVVIGSRALPTLINYSRDVIEQFLTNLRIFHPRRHRLSILKDISGSIKPGRMTLLLGPPGSGKSTLLLALAGKLDSSLKKSGKITYNGHELHEFCVQRTSAYISQTDNHIAELTVRETLDFGARCEGEGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036552`
TK1151 ID	TkA04G037480
OH-1004 ID	LXL04_036552
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036552

Location Chr08:44347002-44354486 (+)

Description Similar to ABCG31: ABC transporter G family member 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29940`	Together with ABCG25, export abscisic acid (ABA) from the endosperm to deliver it to the embryo via ABCG30 and ABCG40-mediated import to suppress radicle extension and subsequent embryonic growth.	The role of Arabidopsis ABCG9 and ABCG31 ATP binding cassette transporters in pollen fitness and the deposition of steryl glycosides on the pollen coat.2014 · DOI: 10.1105/tpc.113.118935 Abscisic acid transporters cooperate to control seed germination.2015 · DOI: 10.1038/ncomms9113

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0205500`	May be a general defense protein.	No verified direct reference in this release
`Os06g0554800`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036552 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009914 hormone transport Biological Process

GO:0010208 pollen wall assembly Biological Process

GO:0010496 intercellular transport Biological Process

GO:0048581 negative regulation of post-embryonic development Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0080168 abscisic acid transport Biological Process

GO:0140352 export from cell Biological Process

GO:1901656 glycoside transport Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT2G29940

dosa:Os06g0554800

dosa:Os10g0205500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.532

Rank 1 · LXL04_036552 · OH-1004

Endoplasmic reticulum0.188

Rank 2 · LXL04_036552 · OH-1004

Lysosome / Vacuole0.154

Rank 3 · LXL04_036552 · OH-1004

Cytoplasm0.122

Rank 4 · LXL04_036552 · OH-1004

Golgi apparatus0.094

Rank 5 · LXL04_036552 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14510.12ABC_trans_N94-144 aa

PF00005.34ABC_tran170-350 aa

PF19055.7ABC2_membrane_7384-437 aa

PF01061.30ABC2_membrane505-717 aa

PF08370.17PDR_assoc722-783 aa

PF00005.34ABC_tran844-995 aa

PF19055.7ABC2_membrane_71024-1084 aa

PF01061.30ABC2_membrane1141-1353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036552	`PF14510.12`	ABC_trans_N	94	144	5.7e-06	27.3
LXL04_036552	`PF00005.34`	ABC_tran	170	350	2.3e-42	145.5
LXL04_036552	`PF19055.7`	ABC2_membrane_7	384	437	1.1e-13	51.6
LXL04_036552	`PF01061.30`	ABC2_membrane	505	717	6.8e-106	353.2
LXL04_036552	`PF08370.17`	PDR_assoc	722	783	5.4e-23	81.2
LXL04_036552	`PF00005.34`	ABC_tran	844	995	2.3e-42	145.5
LXL04_036552	`PF19055.7`	ABC2_membrane_7	1024	1084	1.1e-13	51.6
LXL04_036552	`PF01061.30`	ABC2_membrane	1141	1353	6.8e-106	353.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7PC88`	Arabidopsis thaliana	ABC transporter G family member 31	69.522%	Swiss-Prot	strong database homology
`Q8S628`	Oryza sativa subsp. japonica	ABC transporter G family member 51	62.188%	Swiss-Prot	strong database homology
`Q5Z9S8`	Oryza sativa subsp. japonica	ABC transporter G family member 42	54.351%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card