Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3883 bp · TkA04G034880|TK1151|cDNA
TGGGTTGGGTTTATGGGTTCCCGGTTCGATTTCGGTTTTGATTTCCTTTGAACCTTGAAGCATTTAGCTAAACAAACAGAAAACAATGTGTATAATGTCGTTCCTTGGCTAAAGCTAAGGTTTTCTGTCCTCCACCGCCTTCCTCCAAGTCCAACTCCACAATCACTCATTAAAAAATGAAACCTTTCTTTCTTCCACTGTTGAGAATTCTCTAGAACAGACTGCCAACGACTCCTACAAAGCAAAGAACAAACTACAGC...
1836 bp · TkA04G034880|TK1151|CDS
ATGCTACCTAAGAAGCGACCTGCTGAAGTAATAAAGCTTGACGAAGATAGCAGTAGTGATAGTATAACTGATAATTTGCATAAAAGGCCACGAGTCGGTTGTTTGATCTCTTCTATTTCATCCAGAACGACCACCACCGGAACGACGGATTGTGATCGGAAGGAAAACAGCGGTGGTCAGGAATTTAATAACAACAGCAACAGTAGTTCGGTAGCAGGGAATAGCGTTAACGCCAGTAATATGGGCTTCGAAGATGGTAA...
Protein
Download Protein FASTA611 aa · TkA04G034880|TK1151|PROTEIN
MLPKKRPAEVIKLDEDSSSDSITDNLHKRPRVGCLISSISSRTTTTGTTDCDRKENSGGQEFNNNSNSSSVAGNSVNASNMGFEDGNLQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMQGLGAEIAKNLILAGVKSVTLHDEGAVELWDLSSNFLFSENDVGKNRALASVQKLQELNNAVLVSTLPSKLTKEHLSNFQAVVFTDIDLKTAIEYDNYCHNHNPPIAFIKTEVRGLFGNIFCDFGPEFTVIDVDGEEPH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G034880 |
|---|---|
| TK1151 ID | TkA04G034880 |
| OH-1004 ID | LXL04_036593 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 97.872 / OH-1004 51.330Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G034880 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:9363743-9368834 (+) | |||||||||
| Description | Similar to UBA1: Ubiquitin-activating enzyme E1 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0016567 protein ubiquitination Biological Process GO:0051707 response to other organism Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005777 peroxisome Cellular Component GO:0005829 cytosol Cellular Component GO:0009506 plasmodesma Cellular Component GO:0004839 ubiquitin activating enzyme activity Molecular Function GO:0004842 ubiquitin-protein transferase activity Molecular Function GO:0005524 ATP binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G30110 ath:AT5G06460 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00899ThiF96-473 aaPF13102Phage_int_SAM_5192-222 aaPF16190E1_FCCH270-340 aaPF16191E1_4HB342-411 aaPF13102Phage_int_SAM_5415-431 aaPF00899ThiF493-598 aaPF29668BilD_C513-581 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G034880 | PF00899 | ThiF | 96 | 473 | 1.4e-60 | 205.2 |
| TkA04G034880 | PF13102 | Phage_int_SAM_5 | 192 | 222 | 0.29 | 12.2 |
| TkA04G034880 | PF16190 | E1_FCCH | 270 | 340 | 3.5e-29 | 101.4 |
| TkA04G034880 | PF16191 | E1_4HB | 342 | 411 | 5.7e-25 | 87.8 |
| TkA04G034880 | PF13102 | Phage_int_SAM_5 | 415 | 431 | 0.29 | 12.2 |
| TkA04G034880 | PF00899 | ThiF | 493 | 598 | 1.4e-60 | 205.2 |
| TkA04G034880 | PF29668 | BilD_C | 513 | 581 | 0.0026 | 18.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.