TkA04G034780 | RubberDandelionOmics

Gene overview

TkA04G034780

Reference: TK1151 Chr: Chr04 Coordinates: 9324544-9325139 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

414 bp · TkA04G034780|TK1151|cDNA

ATGGATATACCATCCGAAACAGGGTCAAACGACCCGGGACCATCGCCGACTGGTGGTCCTGCCGACAACTCCTCCTCCGCCGCAAGGTCAACGCTACAACCACCGAGCAGATACGAGTCTCAGAAACGACGCGACTGGAACACCTTCTTACAGTACCTGAGCAACCACAAGCCGCCGTTAACTCTGGCGAGGTGCAGTGGAGCTCACGTCATCGAGTTTCTTAAATACCTTGACCAACGCGTTGATCGGGCGGCTCCGGG...

CDS

Download CDS FASTA

414 bp · TkA04G034780|TK1151|CDS

ATGGATATACCATCCGAAACAGGGTCAAACGACCCGGGACCATCGCCGACTGGTGGTCCTGCCGACAACTCCTCCTCCGCCGCAAGGTCAACGCTACAACCACCGAGCAGATACGAGTCTCAGAAACGACGCGACTGGAACACCTTCTTACAGTACCTGAGCAACCACAAGCCGCCGTTAACTCTGGCGAGGTGCAGTGGAGCTCACGTCATCGAGTTTCTTAAATACCTTGACCAACGCGTTGATCGGGCGGCTCCGGG...

Protein

Download Protein FASTA

137 aa · TkA04G034780|TK1151|PROTEIN

MDIPSETGSNDPGPSPTGGPADNSSSAARSTLQPPSRYESQKRRDWNTFLQYLSNHKPPLTLARCSGAHVIEFLKYLDQRVDRAAPGGVRGERWSSGGEPFWCESCEDVLEGSERKSSQSSRYSLREKEEKTRWRHF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G034780`
TK1151 ID	TkA04G034780
OH-1004 ID	LXL04_036599
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 57.664 / OH-1004 38.164 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G034780

Location Chr04:9324544-9325139 (-)

Description Similar to LSH6: Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58500`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release
`At1g07090`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0472000`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release
`UniProt: A2Y5N0`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release
`UniProt: A2XED8`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036599 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009299 mRNA transcription Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0090698 post-embryonic plant morphogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G07090

ath:AT5G58500

dosa:Os05g0347400

osa:107278610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.769

Rank 1 · TkA04G034780 · TK1151

Cytoplasm0.286

Rank 2 · TkA04G034780 · TK1151

Mitochondrion0.056

Rank 3 · TkA04G034780 · TK1151

Cell membrane0.030

Rank 4 · TkA04G034780 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA04G034780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04852ALOG_dom33-79 aa

PF18392CSN7a_helixI74-84 aa

PF18392CSN7a_helixI102-116 aa

PF04852ALOG_dom118-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G034780	`PF04852`	ALOG_dom	33	79	2.3e-21	77.0
TkA04G034780	`PF18392`	CSN7a_helixI	74	84	0.022	15.4
TkA04G034780	`PF18392`	CSN7a_helixI	102	116	0.022	15.4
TkA04G034780	`PF04852`	ALOG_dom	118	135	2.3e-21	77.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGH2`	Arabidopsis thaliana	sp\|Q9FGH2\|LSH5_ARATH Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5	83.000%	Swiss-Prot	Low
`Q9LMK2`	Arabidopsis thaliana	sp\|Q9LMK2\|LSH6_ARATH Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6	93.300%	Swiss-Prot	Low
`Q6ATW6`	Oryza sativa subsp. japonica	sp\|Q6ATW6\|G1L8_ORYSJ Protein G1-like8	84.600%	Swiss-Prot	Low
`A2Y5N0`	Oryza sativa subsp. indica	sp\|A2Y5N0\|G1L8_ORYSI Protein G1-like8	84.600%	Swiss-Prot	Low
`A2XED8`	Oryza sativa subsp. indica	sp\|A2XED8\|G1L7_ORYSI Protein G1-like7	70.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card