LXL04_036599 | RubberDandelionOmics

Gene overview

LXL04_036599

Reference: OH-1004 Chr: Chr08 Coordinates: 45124819-45125442 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · LXL04_036599|LXL04_036599|OH1004|cDNA

ATGGATATACCATCCGAAACAGGGTCAAACGACCCGGGACCATCGCCGACTGGTGGTCCTGCCGACAACTCCTCCTCCGCCGCAAGGTCAACGCTACAACCACCGAGCAGATACGAGTCTCAGAAACGACGCGACTGGAACACCTTCTTACAGTACCTGAGCAACCACAAGCCGCCGTTAACTCTGGCGAGGTGCAGTGGAGCTCTCGTCATCGAGTTTCTTAAATACCTTGACCAGTTCGGGAAAACGAAAGTGCATGT...

CDS

Download CDS FASTA

624 bp · LXL04_036599|LXL04_036599|OH1004|CDS

ATGGATATACCATCCGAAACAGGGTCAAACGACCCGGGACCATCGCCGACTGGTGGTCCTGCCGACAACTCCTCCTCCGCCGCAAGGTCAACGCTACAACCACCGAGCAGATACGAGTCTCAGAAACGACGCGACTGGAACACCTTCTTACAGTACCTGAGCAACCACAAGCCGCCGTTAACTCTGGCGAGGTGCAGTGGAGCTCTCGTCATCGAGTTTCTTAAATACCTTGACCAGTTCGGGAAAACGAAAGTGCATGT...

Protein

Download Protein FASTA

207 aa · LXL04_036599|LXL04_036599|OH1004|PROTEIN

MDIPSETGSNDPGPSPTGGPADNSSSAARSTLQPPSRYESQKRRDWNTFLQYLSNHKPPLTLARCSGALVIEFLKYLDQFGKTKVHVTDCPYFGQPNPPAPCVCQLRQAWGSLDALIGRLRAAYEENGGRPEANPFGARAVRMYLREVRESQAKARGIPYEKKRKRPGGGTSAAMKVSVAVDGGGGEDGGGGDAAAISSRSPATSTH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036599`
TK1151 ID	TkA04G034780
OH-1004 ID	LXL04_036599
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 57.664 / OH-1004 38.164 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036599

Location Chr08:45124819-45125442 (+)

Description Similar to LSH6: Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07090`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release
`At5g58500`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0347400`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release
`UniProt: A2Y3I2`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release
`Os01g0828900`	Probable transcription regulator that acts as a developmental regulator by promoting cell growth in response to light.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036599 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009299 mRNA transcription Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0090698 post-embryonic plant morphogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G07090

ath:AT5G58500

dosa:Os05g0347400

osa:107278610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.916

Rank 1 · LXL04_036599 · OH-1004

Cytoplasm0.186

Rank 2 · LXL04_036599 · OH-1004

Mitochondrion0.027

Rank 3 · LXL04_036599 · OH-1004

Cell membrane0.020

Rank 4 · LXL04_036599 · OH-1004

Extracellular0.013

Rank 5 · LXL04_036599 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04852.18ALOG_dom33-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036599	`PF04852.18`	ALOG_dom	33	150	5.5e-63	211.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMK2`	Arabidopsis thaliana	Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 6	66.839%	Swiss-Prot	strong database homology
`Q9FGH2`	Arabidopsis thaliana	Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 5	70.659%	Swiss-Prot	strong database homology
`Q5W659`	Oryza sativa subsp. japonica	Protein G1-like9	88.550%	Swiss-Prot	moderate database homology
`A2Y3I2`	Oryza sativa subsp. indica	Protein G1-like9	88.550%	Swiss-Prot	moderate database homology
`Q941W1`	Oryza sativa subsp. japonica	Protein G1-like7	82.443%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card