RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G031430
Reference: TK1151 Chr: Chr04 Coordinates: 8273476-8278117 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2007 bp · TkA04G031430|TK1151|cDNA

AAAAATCTTATGGATGAAAGATAACATGGAATTCAAGCTCAGAGTACTCACCGCCTTAGGTTTCTTAGTTGGTGCCAAGGTAAGTACTAAATGTTCAGGTTCCATTCTTATTCAAGCTCGCTGTTGATTGGTTAACAACAGCATCAGGGAACCCTAGTACAATTTCTGAATTTGCAGCCTCAAATCCAACAGCTTTAGCTGTTTTCGTGAGTCCTGCTGCTGTTTTGATTGGTTATGGTATTGCAAGGACAGGGGCTTCT...

CDS

Download CDS FASTA

1365 bp · TkA04G031430|TK1151|CDS

ATGGTGTTCAATGTTGTTCCAACTGTGTTAGAGATTACAATGGTGGGAGGTATTCTCGCGTACAAATTTGGATCAGTGTTTGCAATAATTACATCTTTGTCTGTTGCTGCGTATGTTACCTTCACTTTGACTATAACACAATGGAGGACTAAATTCAGGAAGATAATGAACAAAGCTGATAATGATGCAAGCACAAGAGCAATTGATTCACTTATAAATTATGAAACTGTGAAGTATTTCAACAATGAACAATATGAAGC...

Protein

Download Protein FASTA

454 aa · TkA04G031430|TK1151|PROTEIN

MVFNVVPTVLEITMVGGILAYKFGSVFAIITSLSVAAYVTFTLTITQWRTKFRKIMNKADNDASTRAIDSLINYETVKYFNNEQYEADEYDKYLKRYEDAALKTQRSLAILNFGQTLVFSTALSAAMVLTSNGILNGQMTVGDLVMVNGLLFQLSLPLNFLGSVYRETVQSLVDMKSMFQLLEEKAEVGDAVDAKPIKFGGGSIEFENVHFSYLPERKILDGISFVVPAGKSVAIVGTSGSGKSTILRMIFRFFDTNSGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G031430
TK1151 IDTkA04G031430
OH-1004 IDLXL04_036663
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)97.800
Protein coverage (%)TK1151 100.000 / OH-1004 61.376
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G031430
LocationChr04:8273476-8278117 (-)
DescriptionSimilar to ABCB25: ABC transporter B family member 25, mitochondrial
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g58270 Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins.
An allelic mutant series of ATM3 reveals its key role in the biogenesis of cytosolic iron-sulfur proteins in Arabidopsis.2009 · DOI: 10.1104/pp.109.143651
A novel role for Arabidopsis mitochondrial ABC transporter ATM3 in molybdenum cofactor biosynthesis.2010 · DOI: 10.1105/tpc.109.068478
At4g28630 Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins.
A mutation of the mitochondrial ABC transporter Sta1 leads to dwarfism and chlorosis in the Arabidopsis mutant starik.2001 · DOI: 10.1105/tpc.13.1.89
At4g28620 Performs an essential function in the generation of cytoplasmic iron-sulfur proteins by mediating export of Fe/S cluster precursors synthesized by NFS1 and other mitochondrial proteins (By similarity). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036663 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006777 Mo-molybdopterin cofactor biosynthetic process Biological Process
GO:0006826 iron ion transport Biological Process
GO:0006879 intracellular iron ion homeostasis Biological Process
GO:0009555 pollen development Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0010288 response to lead ion Biological Process
GO:0010312 detoxification of zinc ion Biological Process
GO:0010380 regulation of chlorophyll biosynthetic process Biological Process
GO:0016226 iron-sulfur cluster assembly Biological Process
GO:0046686 response to cadmium ion Biological Process
GO:0048364 root development Biological Process
GO:0051276 chromosome organization Biological Process
KEGG gene cross-reference
ath:AT4G28620
ath:AT4G28630
ath:AT5G58270
dre:566515
ola:101168300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.250
Rank 1 · TkA04G031430 · TK1151
Cytoplasm0.239
Rank 2 · TkA04G031430 · TK1151
Mitochondrion0.220
Rank 3 · TkA04G031430 · TK1151
Lysosome / Vacuole0.118
Rank 4 · TkA04G031430 · TK1151
Cell membrane0.111
Rank 5 · TkA04G031430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664ABC_membrane13-157 aa
PF13175AAA_1555-94 aa
PF01935DUF8758-99 aa
PF13173AAA_1473-98 aa
PF00485PRK75-98 aa
PF13476AAA_2378-104 aa
PF25199nSTAND_NTPase5201-250 aa
PF00158Sigma54_activat219-270 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G031430PF00664ABC_membrane131573e-2383.6
TkA04G031430PF13175AAA_1555940.0006820.0
TkA04G031430PF01935DUF8758990.01915.8
TkA04G031430PF13173AAA_1473980.04914.3
TkA04G031430PF00485PRK75980.2112.1
TkA04G031430PF13476AAA_23781040.03915.3
TkA04G031430PF25199nSTAND_NTPase52012500.0116.4
TkA04G031430PF00158Sigma54_activat2192700.1912.1
TkA04G031430PF00005ABC_tran2203693.2e-33115.9
TkA04G031430PF13481AAA_252222470.2611.6
TkA04G031430PF13555AAA_292292470.001718.8
TkA04G031430PF13191AAA_162303700.001220.1
TkA04G031430PF13479AAA_242302830.001618.9
TkA04G031430PF13476AAA_232302510.03915.3
TkA04G031430PF03193RsgA_GTPase2302610.07513.6
TkA04G031430PF06414Zeta_toxin2312710.0007419.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LVM1Arabidopsis thalianasp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial81.700%Swiss-ProtHigh
Q9FUT3Arabidopsis thalianasp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial77.200%Swiss-ProtHigh
Q9M0G9Arabidopsis thalianasp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial74.900%Swiss-ProtHigh

JBrowse

View in Genome Browser