TkA04G022640 | RubberDandelionOmics

Gene overview

TkA04G022640

Reference: TK1151 Chr: Chr04 Coordinates: 5741442-5744501 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1907 bp · TkA04G022640|TK1151|cDNA

ATCCAACGGTTCTAATACAACAAAACCCTCCCAAATTCCCAAACCGAAGTTTTCAAAATCCCCTCTCTTCCTCCATAGATCTCATCTTCTCTCTGAAACCCCTACACTCGATACTCACGACGACAGCATCGCAATCTCTCTGCAAATTCCCCCTTTTTATACCTCATCGCACAAGGAAAAGGAACGCAATTACCCTCTTCAGTACTAATCTACCCATTCAAAAAGTTAAGTGTTTGTGATCCTAGATGCTCGATTTCACT...

CDS

Download CDS FASTA

405 bp · TkA04G022640|TK1151|CDS

ATGTTACAGAGGAAACTTTATCCAATGAAGAAGGGGAATCAAAGTCGGTTTATGTCAGGAACTTACCCACATCTGTTACTAGTCTTGAAATACTTCAAGAATCAAGAATTTCGGGAAAATCAAGCAAGATGGCCTTTTCTTAAAGAATCGAAAGGATGTCGGTATTGTTTTGCCTTTGTCGAGTTTGAGGATGTTGGTGGTGTTCAAAAAGCCATTGAGGCATCCCCAATACAGTTGGCTGGTAGACAAGTGTACATCGA...

Protein

Download Protein FASTA

134 aa · TkA04G022640|TK1151|PROTEIN

MLQRKLYPMKKGNQSRFMSGTYPHLLLVLKYFKNQEFRENQARWPFLKESKGCRYCFAFVEFEDVGGVQKAIEASPIQLAGRQVYIEERRTNSSNSSRGGRGGGRGRGSYNDASRGGGRYGGGSNGRGNGFRNV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G022640`
TK1151 ID	TkA04G022640
OH-1004 ID	LXL04_036822
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.700
Protein coverage (%)	TK1151 81.343 / OH-1004 23.884 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G022640`
Location	Chr04:5741442-5744501 (+)
Description	Similar to NTF2: Nuclear transport factor 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036822` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007265 Ras protein signal transduction Biological Process GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process GO:0032481 positive regulation of type I interferon production Biological Process GO:0034063 stress granule assembly Biological Process GO:0045087 innate immune response Biological Process GO:0051028 mRNA transport Biological Process GO:0051607 defense response to virus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005925 focal adhesion Cellular Component GO:0009536 plastid Cellular Component
KEGG gene cross-reference	ath:AT5G60980 bta:534214 hsa:10146 pon:100172476 spo:2541364 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.540

Rank 1 · TkA04G022640 · TK1151

Cytoplasm0.429

Rank 2 · TkA04G022640 · TK1151

Mitochondrion0.088

Rank 3 · TkA04G022640 · TK1151

Endoplasmic reticulum0.040

Rank 4 · TkA04G022640 · TK1151

Extracellular0.040

Rank 5 · TkA04G022640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076RRM_154-82 aa

PF30866NUP53_M59-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G022640	`PF00076`	RRM_1	54	82	0.013	16.1
TkA04G022640	`PF30866`	NUP53_M	59	92	0.18	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card