LXL04_036822 | RubberDandelionOmics

Gene overview

LXL04_036822

Reference: OH-1004 Chr: Chr08 Coordinates: 48820915-48823416 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1347 bp · LXL04_036822|LXL04_036822|OH1004|cDNA

ATGGCGAGCTCTTACTCATCCTCTGTTACCGCTTCTCAgGTTGGTTCGTACTTTGTTCAGCAGTACTATCAGGTGCTTCAACAACAACCAGAATTCGTTCATCAGTTTTACACCGATTCCAGTACCATGATTCGGGTTGATGGCGAATCCACTGAAACCGCATCAGCTATATTCCAAATTCACACACTTATTCAGTCCTCACTTTTTAGTGGGATTGAAATCAAGACCATAAACTCTGTTGAATCATGGAGTGAAGGGAT...

CDS

Download CDS FASTA

1347 bp · LXL04_036822|LXL04_036822|OH1004|CDS

ATGGCGAGCTCTTACTCATCCTCTGTTACCGCTTCTCAGGTTGGTTCGTACTTTGTTCAGCAGTACTATCAGGTGCTTCAACAACAACCAGAATTCGTTCATCAGTTTTACACCGATTCCAGTACCATGATTCGGGTTGATGGCGAATCCACTGAAACCGCATCAGCTATATTCCAAATTCACACACTTATTCAGTCCTCACTTTTTAGTGGGATTGAAATCAAGACCATAAACTCTGTTGAATCATGGAGTGAAGGGAT...

Protein

Download Protein FASTA

448 aa · LXL04_036822|LXL04_036822|OH1004|PROTEIN

MASSYSSSVTASQVGSYFVQQYYQVLQQQPEFVHQFYTDSSTMIRVDGESTETASAIFQIHTLIQSSLFSGIEIKTINSVESWSEGIVVVVSGSVKSKYFNGWRKFVQTFFLAPQEKGYFVMNDIFHFVSEESTNHLPPPMAATHTDDFQPISSTTPDQLVAEDVLEVETRDNFNSLHLQNEDQGNYYTSQEQQHQHQHQQQEQEDDESEEEEEYEDEPQVEDHVHNHNHNHVEYVQEPFHHETVEYIQEPLPPVQEPTR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036822`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036822

Location Chr08:48820915-48823416 (-)

Description Similar to NTF2: Nuclear transport factor 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60980`	Involved in RNA-directed DNA methylation (RdDM).	AtMBD6, a methyl CpG binding domain protein, maintains gene silencing in Arabidopsis by interacting with RNA binding proteins.2017 · DOI: 10.1007/s12038-016-9658-1

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036822 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007265 Ras protein signal transduction Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0032481 positive regulation of type I interferon production Biological Process

GO:0034063 stress granule assembly Biological Process

GO:0045087 innate immune response Biological Process

GO:0051028 mRNA transport Biological Process

GO:0051607 defense response to virus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005925 focal adhesion Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT5G60980

bta:534214

hsa:10146

pon:100172476

spo:2541364

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.734

Rank 1 · LXL04_036822 · OH-1004

Nucleus0.338

Rank 2 · LXL04_036822 · OH-1004

Golgi apparatus0.056

Rank 3 · LXL04_036822 · OH-1004

Endoplasmic reticulum0.055

Rank 4 · LXL04_036822 · OH-1004

Lysosome / Vacuole0.050

Rank 5 · LXL04_036822 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02136.27NTF214-128 aa

PF00076.29RRM_1330-395 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036822	`PF02136.27`	NTF2	14	128	3.7e-24	86.1
LXL04_036822	`PF00076.29`	RRM_1	330	395	5.1e-10	39.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FME2`	Arabidopsis thaliana	Nuclear transport factor 2	32.426%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card