Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4094 bp · TkA04G020510|TK1151|cDNA
AAACACGACAGTGTTTGCTGCGGCCTCCGCCTGGTGTGGTAGAAAAGCCAACCGACCCGACTGGTTCAAAGCTACAAATACGACCGCCGTTTGATTTATTTTCCTCCGATCGATTTAGGTTACTTTTGGGAAGAGCGAAATCAGAAACACAGTTGAGTTCATAAATTGCGGTATCCGCTAATCTAGGGCTCGATTGATCGTATAATTGAGATGTATATGTTCTCTGTTTTCCTTAATTTCTAGAAATCAATCGAACACCA...
642 bp · TkA04G020510|TK1151|CDS
ATGGAAAAAAGAGAAGGCCTTTGCCTGGAAAGAGATGGAGGAAGGCAGCATCGCGTGAGGACAATGAAGAAATCGATGACACAAGAGATTCCTATCGAAGAAGAAGAAGACAATCAAGAAAATGATGATGGAGAAGATGAAGACAACAATCCTTCTTTCATAACCCTAGAAGGCGGATTAAAGATCCCATCATCCATCTTCACCCAACTCTTCGACTACCAAAAAGTCGGAGTCCAATGGCTATGGGAGCTCCACTGCCA...
Protein
Download Protein FASTA213 aa · TkA04G020510|TK1151|PROTEIN
MEKREGLCLERDGGRQHRVRTMKKSMTQEIPIEEEEDNQENDDGEDEDNNPSFITLEGGLKIPSSIFTQLFDYQKVGVQWLWELHCQKAGGIIGDEMGLGKTIQVLSFLASLHFSNLYKPSIIICPVTLLRQWKRESKKWYPTFHTEILHDSALEPSRKKQKKSDSNSDNETTESDNEEEGRAKSVKVSKGKKWDGLINRVLGSESGFVDNDL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G020510 |
|---|---|
| TK1151 ID | TkA04G020510 |
| OH-1004 ID | LXL04_036859 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 91.000 |
| Protein coverage (%) | TK1151 76.056 / OH-1004 14.093Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G020510 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:5200779-5206936 (-) | ||||||||||||
| Description | Similar to CHR8: Protein CHROMATIN REMODELING 8 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000012 single strand break repair Biological Process GO:0000077 DNA damage checkpoint signaling Biological Process GO:0006281 DNA repair Biological Process GO:0006283 transcription-coupled nucleotide-excision repair Biological Process GO:0006284 base-excision repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006366 transcription by RNA polymerase II Biological Process GO:0006974 DNA damage response Biological Process GO:0006979 response to oxidative stress Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT2G18760 dosa:Os01g0102800 hsa:2074 osa:4326441 sce:YJR035W spo:2539473 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14851FAM17622-47 aaPF19435IntS14_b-barrel26-64 aaPF11521TFIIE-A_C33-50 aaPF09026CENP-B_dimeris34-50 aaPF04851ResIII69-161 aaPF00176SNF2-rel_dom73-156 aaPF19339ANGEL2_N110-192 aaPF14851FAM176156-183 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G020510 | PF14851 | FAM176 | 22 | 47 | 0.69 | 10.4 |
| TkA04G020510 | PF19435 | IntS14_b-barrel | 26 | 64 | 0.067 | 14.0 |
| TkA04G020510 | PF11521 | TFIIE-A_C | 33 | 50 | 6.0 | 8.0 |
| TkA04G020510 | PF09026 | CENP-B_dimeris | 34 | 50 | 0.7 | 11.1 |
| TkA04G020510 | PF04851 | ResIII | 69 | 161 | 0.00013 | 22.6 |
| TkA04G020510 | PF00176 | SNF2-rel_dom | 73 | 156 | 4.3e-23 | 82.5 |
| TkA04G020510 | PF19339 | ANGEL2_N | 110 | 192 | 0.059 | 13.9 |
| TkA04G020510 | PF14851 | FAM176 | 156 | 183 | 0.69 | 10.4 |
| TkA04G020510 | PF11521 | TFIIE-A_C | 157 | 189 | 6.0 | 8.0 |
| TkA04G020510 | PF19435 | IntS14_b-barrel | 159 | 185 | 0.067 | 14.0 |
| TkA04G020510 | PF09026 | CENP-B_dimeris | 163 | 180 | 0.7 | 11.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.