TkA04G017480 | RubberDandelionOmics

Gene overview

TkA04G017480

Reference: TK1151 Chr: Chr04 Coordinates: 4353769-4354500 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · TkA04G017480|TK1151|cDNA

ATGCCGGTGTCAACTAGGTCTCATGTGAAGTTGATTCAAGCTCGGAGTGAGGAAGAGAACAACCATATGCAGGATCATCATCAATTGAGGAATCCTCATCACGGTTTGAAAGAAAAGATGAAAGCTTTGACCCAATTGTACGAACAGCAGAAACAATCGTCAATTGCTCTCAGAAACCCTTCTCCTAAACCAGACGCAAATCGATTTTCAACGCATCCAAGCGTGGATCTTTTGGCTGGTACTGGATCTTGCAAAAAAGA...

CDS

Download CDS FASTA

663 bp · TkA04G017480|TK1151|CDS

ATGCCGGTGTCAACTAGGTCTCATGTGAAGTTGATTCAAGCTCGGAGTGAGGAAGAGAACAACCATATGCAGGATCATCATCAATTGAGGAATCCTCATCACGGTTTGAAAGAAAAGATGAAAGCTTTGACCCAATTGTACGAACAGCAGAAACAATCGTCAATTGCTCTCAGAAACCCTTCTCCTAAACCAGACGCAAATCGATTTTCAACGCATCCAAGCGTGGATCTTTTGGCTGGTACTGGATCTTGCAAAAAAGA...

Protein

Download Protein FASTA

220 aa · TkA04G017480|TK1151|PROTEIN

MPVSTRSHVKLIQARSEEENNHMQDHHQLRNPHHGLKEKMKALTQLYEQQKQSSIALRNPSPKPDANRFSTHPSVDLLAGTGSCKKESDNQKKSRTIETHVMRENSMPISSTFTKNYILPRQPPTTSSDIVDLQYFGFHSIHRRKSSIGNNSDAGAGGGDSDDEEGEVQSKDNGPLNELSNYLLKPVNGLNLTGHINLNDVLCTKKNKDQMWTNSERFYP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G017480`
TK1151 ID	TkA04G017480
OH-1004 ID	LXL04_031514
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.000
Protein coverage (%)	TK1151 58.636 / OH-1004 16.602 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G017480

Location Chr04:4353769-4354500 (+)

Description Similar to KIN8A: Kinesin-like protein KIN-8A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18550`	Kinesin-like protein KIN-8A.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031514 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0007019 microtubule depolymerization Biological Process

GO:0060404 axonemal microtubule depolymerization Biological Process

GO:0070462 plus-end specific microtubule depolymerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0005929 cilium Cellular Component

GO:0005930 axoneme Cellular Component

GO:0061673 mitotic spindle astral microtubule Cellular Component

KEGG gene cross-reference

ath:AT1G18550

dosa:Os01g0605500

hsa:124602

mmu:286942

osa:4324211

xla:373792

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.484

Rank 1 · TkA04G017480 · TK1151

Cytoplasm0.426

Rank 2 · TkA04G017480 · TK1151

Cell membrane0.073

Rank 3 · TkA04G017480 · TK1151

Mitochondrion0.058

Rank 4 · TkA04G017480 · TK1151

Lysosome / Vacuole0.034

Rank 5 · TkA04G017480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22437DBF4_BRCT15-63 aa

PF22437DBF4_BRCT89-110 aa

PF30470OXS3144-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G017480	`PF22437`	DBF4_BRCT	15	63	5.8	8.7
TkA04G017480	`PF22437`	DBF4_BRCT	89	110	5.8	8.7
TkA04G017480	`PF30470`	OXS3	144	180	0.003	18.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4ICA0`	Arabidopsis thaliana	sp\|F4ICA0\|KN8A_ARATH Kinesin-like protein KIN-8A	60.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card