TkA04G017170 | RubberDandelionOmics

Gene overview

TkA04G017170

Reference: TK1151 Chr: Chr04 Coordinates: 4268532-4272302 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1125 bp · TkA04G017170|TK1151|cDNA

ATGGACGATGCTTCTGGAAGCGGTAAAAGGTTCCGTGACGACGTCGTTGATAGCCGGATTTCCTCTTCGGTAAATGGGTTTCAAGGTCAGCCTATGGCTAACCCGGTTCAAACGGCTCCAAATCCACCGGCTGCCCGTCCGACTAGGGTCAGAGCTAGGCGAGGTCAGGCCACTGACCCACACAGTATTGCTGAGAGGCTTCGGCGAGAAAGAATAGCGGAGAGAATCAGAGCGTTACAAGAACTGGTTCCTAGTGTAAA...

CDS

Download CDS FASTA

639 bp · TkA04G017170|TK1151|CDS

ATGGACGATGCTTCTGGAAGCGGTAAAAGGTTCCGTGACGACGTCGTTGATAGCCGGATTTCCTCTTCGGTAAATGGGTTTCAAGGTCAGCCTATGGCTAACCCGGTTCAAACGGCTCCAAATCCACCGGCTGCCCGTCCGACTAGGGTCAGAGCTAGGCGAGGTCAGGCCACTGACCCACACAGTATTGCTGAGAGGCTTCGGCGAGAAAGAATAGCGGAGAGAATCAGAGCGTTACAAGAACTGGTTCCTAGTGTAAA...

Protein

Download Protein FASTA

212 aa · TkA04G017170|TK1151|PROTEIN

MDDASGSGKRFRDDVVDSRISSSVNGFQGQPMANPVQTAPNPPAARPTRVRARRGQATDPHSIAERLRRERIAERIRALQELVPSVNKTDRAAMLDEIVDYVKFLRLQVKVLSMSRLGGASAVAPLVTDIPISSVEEEGGEGGRNQPAWEKWSNDGTERQVAKLMEENVGAAMQFLQSKALCIMPISLASAIYHTQPPDSTSIVKPESEPPL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G017170`
TK1151 ID	TkA04G017170
OH-1004 ID	LXL04_003442
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.400
Protein coverage (%)	TK1151 87.264 / OH-1004 62.585 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G017170

Location Chr04:4268532-4272302 (+)

Description Similar to UNE12: Transcription factor UNE12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02590`	Required for ovule fertilization.	No verified direct reference in this release
`At1g03040`	Transcription factor bHLH7.	No verified direct reference in this release
`At2g24260`	Transcription factor that regulates the development of root hairs.	Conservation of lotus and Arabidopsis basic helix-loop-helix proteins reveals new players in root hair development.2009 · DOI: 10.1104/pp.109.143867
`At5g58010`	Transcription factor that regulates the development of root hairs.	Conservation of lotus and Arabidopsis basic helix-loop-helix proteins reveals new players in root hair development.2009 · DOI: 10.1104/pp.109.143867

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003442 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0048767 root hair elongation Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0080147 root hair cell development Biological Process

KEGG gene cross-reference

ath:AT1G03040

ath:AT2G24260

ath:AT4G02590

ath:AT4G30980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA04G017170 · TK1151

Cytoplasm0.092

Rank 2 · TkA04G017170 · TK1151

Cell membrane0.023

Rank 3 · TkA04G017170 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA04G017170 · TK1151

Plastid0.010

Rank 5 · TkA04G017170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00772DnaB53-103 aa

PF00010HLH61-106 aa

PF23177bHLH_IRO363-113 aa

PF23173bHLH_SAC5165-108 aa

PF26228RESC9_N65-112 aa

PF04281Tom2266-103 aa

PF23176bHLH_LHW69-106 aa

PF00772DnaB116-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G017170	`PF00772`	DnaB	53	103	0.2	12.4
TkA04G017170	`PF00010`	HLH	61	106	2.3e-08	34.4
TkA04G017170	`PF23177`	bHLH_IRO3	63	113	0.0013	19.7
TkA04G017170	`PF23173`	bHLH_SAC51	65	108	1.3e-05	25.7
TkA04G017170	`PF26228`	RESC9_N	65	112	0.21	10.9
TkA04G017170	`PF04281`	Tom22	66	103	0.13	12.8
TkA04G017170	`PF23176`	bHLH_LHW	69	106	0.054	14.2
TkA04G017170	`PF00772`	DnaB	116	133	0.2	12.4
TkA04G017170	`PF23176`	bHLH_LHW	164	178	0.054	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22768`	Arabidopsis thaliana	sp\|O22768\|UNE12_ARATH Transcription factor UNE12	81.300%	Swiss-Prot	High
`Q93Y00`	Arabidopsis thaliana	sp\|Q93Y00\|BH007_ARATH Transcription factor bHLH7	76.700%	Swiss-Prot	High
`Q9ZUG9`	Arabidopsis thaliana	sp\|Q9ZUG9\|LRL1_ARATH Transcription factor LRL1	64.600%	Swiss-Prot	High
`Q9LSQ3`	Arabidopsis thaliana	sp\|Q9LSQ3\|LRL3_ARATH Transcription factor LRL3	54.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card