TkA04G011060 | RubberDandelionOmics

Gene overview

TkA04G011060

Reference: TK1151 Chr: Chr04 Coordinates: 2661882-2667076 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1955 bp · TkA04G011060|TK1151|cDNA

CGGTATCCAACACACTCGCACTCTCGCAGTGGAAAGAAAATCCAACCAGCTGCCCCGCCCTGCTCTACCGCTCACTGGCGGTTTCCGGCTATTGGCACGGACGCACGATTCTTTGTATATGCAGTAAGCATGAAGATCATAGGCTGTAATTGTATTCCAAAATCAAGCATATTGATTGCTCACCATGAGATATCTTCCCTTACATTTTGCAATCCCCTTAAAACCACTACATCAGCTTTATTGATTTCAAATCATCAACA...

CDS

Download CDS FASTA

1704 bp · TkA04G011060|TK1151|CDS

CGGTATCCAACACACTCGCACTCTCGCAGTGGAAAGAAAATCCAACCAGCTGCCCCGCCCTGCTCTACCGCTCACTGGCGGTTTCCGGCTATTGGCACGGACGCACGATTCTTTGTATATGCAGTAAGCATGAAGATCATAGGCTGTAATTGTATTCCAAAATCAAGCATATTGATTGCTCACCATGAGATATCTTCCCTTACATTTTGCAATCCCCTTAAAACCACTACATCAGCTTTATTGATTTCAAATCATCAACA...

Protein

Download Protein FASTA

567 aa · TkA04G011060|TK1151|PROTEIN

RYPTHSHSRSGKKIQPAAPPCSTAHWRFPAIGTDARFFVYAVSMKIIGCNCIPKSSILIAHHEISSLTFCNPLKTTTSALLISNHQHKRPNFITKLQCSVASRPYSSNSTNSSTSKSDSVRMNRKQGGSSSIYSRTSLLEMKNERIANRARVYDFLKGIGIEPDELDGLELPVTVDVMKERVDFLHTLGLTIEDINNYPLVLGCSVKKNMIPVLDYLGKLGVKRSTLTDFLQRYPQVLHASVVVDLAPVVKYLEGMDIKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G011060`
TK1151 ID	TkA04G011060
OH-1004 ID	LXL04_037008
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 63.851 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G011060

Location Chr04:2661882-2667076 (-)

Description Similar to MTERF4: Transcription termination factor MTERF4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02990`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	No verified direct reference in this release
`At2g21710`	Transcription termination factor involved in processing of plastid transcripts (By similarity).	No verified direct reference in this release
`At5g54180`	Transcription termination factor that is transcriptionally active in chloroplasts.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0404000`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037008 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000460 maturation of 5.8S rRNA Biological Process

GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006396 RNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0032502 developmental process Biological Process

GO:0034475 U4 snRNA 3'-end processing Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0042793 plastid transcription Biological Process

GO:0042794 plastid rRNA transcription Biological Process

KEGG gene cross-reference

ath:AT1G03360

ath:AT4G02990

dosa:Os05g0404000

spo:2541813

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.919

Rank 1 · TkA04G011060 · TK1151

Mitochondrion0.061

Rank 2 · TkA04G011060 · TK1151

Nucleus0.051

Rank 3 · TkA04G011060 · TK1151

Cytoplasm0.024

Rank 4 · TkA04G011060 · TK1151

Cell membrane0.012

Rank 5 · TkA04G011060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02536mTERF173-212 aa

PF02536mTERF214-522 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G011060	`PF02536`	mTERF	173	212	2.5e-111	372.3
TkA04G011060	`PF02536`	mTERF	214	522	2.5e-111	372.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZT96`	Arabidopsis thaliana	sp\|Q9ZT96\|MTEF4_ARATH Transcription termination factor MTERF4, chloroplastic	68.900%	Swiss-Prot	High
`F4IHL3`	Arabidopsis thaliana	sp\|F4IHL3\|MTEF2_ARATH Transcription termination factor MTERF2, chloroplastic	31.300%	Swiss-Prot	Low
`Q9FK23`	Arabidopsis thaliana	sp\|Q9FK23\|MTEF8_ARATH Transcription termination factor MTERF8, chloroplastic	31.100%	Swiss-Prot	Low
`Q6AUK6`	Oryza sativa subsp. japonica	sp\|Q6AUK6\|MTEF4_ORYSJ Transcription termination factor MTERF4, chloroplastic	77.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card