TkA04G010220 | RubberDandelionOmics

Gene overview

TkA04G010220

Reference: TK1151 Chr: Chr04 Coordinates: 2424515-2435243 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1443 bp · TkA04G010220|TK1151|cDNA

CTGCTGCCACGTTTCGCACACATACAGAGACATATGAACGAGTACACCGCTAATCGTCTTGGGGTTCTTCCGATTTTATCAAAATTTGGGTGCTTTTAGATTACTGCATTTCGAGTACTCCGTCAGTAGAAACAACGACGAAATCTTCACTGTTCATACTTAAAAGCTTATATTTCACAGAAGAAGCGGTATATTAATGCCAATTAAGTTTAGGAAGACTATAGATTTAGAAGAAGGATGGGAGTTTCTGGAGACTGGGA...

CDS

Download CDS FASTA

759 bp · TkA04G010220|TK1151|CDS

ATGCCAATTAAGTTTAGGAAGACTATAGATTTAGAAGAAGGATGGGAGTTTCTGGAGACTGGGATAAACAAATTGAAAAGAATTCTGGAAGGGCATCCTGAACCACAATTTGAGCCTGAAGAGTACATGATGATGTACACCACTGTCTTTAACATGGCCAACCAGAAATGCCGCCATGATTATTCTAGAGAGCTATATGAAAAGTACAAGGAAACAATTCAAGATTACATCAGTTCAATGGTATTGCCATCATTAAGAGA...

Protein

Download Protein FASTA

252 aa · TkA04G010220|TK1151|PROTEIN

MPIKFRKTIDLEEGWEFLETGINKLKRILEGHPEPQFEPEEYMMMYTTVFNMANQKCRHDYSRELYEKYKETIQDYISSMVLPSLREKHGEFMLRELVNRWMNHKVMVKWLYKFFQYLERYFISRRDFPSLDEVALTCFRDMVYEELKGKAKDVVIALIDQEREGEVIDRALVKNVVDIYVEIGMGDMNYYVNDFENDMLSATAVYYSQKASNWIMEDSSSLLKAEDCLRNEKERVSHYLHSSSEAKLLENV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G010220`
TK1151 ID	TkA04G010220
OH-1004 ID	LXL04_037024
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.200
Protein coverage (%)	TK1151 99.206 / OH-1004 95.817 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G010220

Location Chr04:2424515-2435243 (-)

Description Similar to CUL1: Cullin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02570`	Involved in ubiquitination and subsequent proteasomal degradation of target proteins.	Null mutation of AtCUL1 causes arrest in early embryogenesis in Arabidopsis.2002 · DOI: 10.1091/mbc.e02-02-0077 Arabidopsis CAND1, an unmodified CUL1-interacting protein, is involved in multiple developmental pathways controlled by ubiquitin/proteasome-mediated protein Degradation.2004 · DOI: 10.1105/tpc.021949
`At1g59790`	Putative cullin-like protein 2.	No verified direct reference in this release
`At1g43140`	Putative cullin-like protein 1.	No verified direct reference in this release
`At1g02980`	Core component of multiple SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0369000`	Involved in ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037024 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010265 SCF complex assembly Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G02980

ath:AT1G43140

ath:AT1G59790

ath:AT4G02570

dosa:Os01g0369000

osa:4325735

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.687

Rank 1 · TkA04G010220 · TK1151

Nucleus0.316

Rank 2 · TkA04G010220 · TK1151

Cell membrane0.120

Rank 3 · TkA04G010220 · TK1151

Golgi apparatus0.082

Rank 4 · TkA04G010220 · TK1151

Lysosome / Vacuole0.069

Rank 5 · TkA04G010220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00888Cullin15-250 aa

PF29822PM120153-97 aa

PF29822PM1201168-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G010220	`PF00888`	Cullin	15	250	4.3e-48	165.5
TkA04G010220	`PF29822`	PM1201	53	97	0.13	13.0
TkA04G010220	`PF29822`	PM1201	168	235	0.13	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AH6`	Arabidopsis thaliana	sp\|Q94AH6\|CUL1_ARATH Cullin-1	65.900%	Swiss-Prot	High
`Q9XIE9`	Arabidopsis thaliana	sp\|Q9XIE9\|CLL2_ARATH Putative cullin-like protein 2	58.400%	Swiss-Prot	High
`P0CH31`	Arabidopsis thaliana	sp\|P0CH31\|CLL1_ARATH Putative cullin-like protein 1	52.800%	Swiss-Prot	High
`Q9SRZ0`	Arabidopsis thaliana	sp\|Q9SRZ0\|CUL2_ARATH Cullin-2	51.200%	Swiss-Prot	High
`Q5ZC88`	Oryza sativa subsp. japonica	sp\|Q5ZC88\|CUL1_ORYSJ Cullin-1	64.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card