TkA04G008840 | RubberDandelionOmics

Gene overview

TkA04G008840

Reference: TK1151 Chr: Chr04 Coordinates: 2121670-2122480 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · TkA04G008840|TK1151|cDNA

ATGAAGTGCTTGGTCTCTTCTGGAATAAGCAACTCAAATGTATTATCCACCCATGTTCATTGTGATGACACACTTTTCCAGGTTTGGCTTCCACTGAAGACGATTTCTCTTGATTTTGTCCATTATACTATAAATGCTTTCTGTGCAGGTGAATTGGGAGAGACATATTCTTGTGTGAAAATACATATAATGGCTGAAAGCAATGAGCATATAGAGCTTAAATTCAGAATATATGATGGAACAGATATAGGCCATAGCAA...

CDS

Download CDS FASTA

564 bp · TkA04G008840|TK1151|CDS

ATGAAGTGCTTGGTCTCTTCTGGAATAAGCAACTCAAATGTATTATCCACCCATGTTCATTGTGATGACACACTTTTCCAGGTTTGGCTTCCACTGAAGACGATTTCTCTTGATTTTGTCCATTATACTATAAATGCTTTCTGTGCAGGTGAATTGGGAGAGACATATTCTTGTGTGAAAATACATATAATGGCTGAAAGCAATGAGCATATAGAGCTTAAATTCAGAATATATGATGGAACAGATATAGGCCATAGCAA...

Protein

Download Protein FASTA

187 aa · TkA04G008840|TK1151|PROTEIN

MKCLVSSGISNSNVLSTHVHCDDTLFQVWLPLKTISLDFVHYTINAFCAGELGETYSCVKIHIMAESNEHIELKFRIYDGTDIGHSNYALSTTVTALKQKLVSEWPPGKSVVPKTVNDIKIIHSGKVLENNKTLSECGVGDGAFSGGIITMHIVVQPVVNKKKSGQFIPLLLKLYVCIPIFTVYKKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G008840`
TK1151 ID	TkA04G008840
OH-1004 ID	LXL04_037041
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.500
Protein coverage (%)	TK1151 87.701 / OH-1004 77.885 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G008840

Location Chr04:2121670-2122480 (-)

Description Similar to MUB3: Membrane-anchored ubiquitin-fold protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24990`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release
`At1g22050`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0750600`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release
`Os04g0393300`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release
`Os03g0426800`	May serve as docking site to facilitate the association of other proteins to the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037041 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G22050

ath:AT3G26980

ath:AT4G24990

dosa:Os02g0750600

dosa:Os04g0393300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.380

Rank 1 · TkA04G008840 · TK1151

Nucleus0.299

Rank 2 · TkA04G008840 · TK1151

Endoplasmic reticulum0.216

Rank 3 · TkA04G008840 · TK1151

Cell membrane0.156

Rank 4 · TkA04G008840 · TK1151

Golgi apparatus0.130

Rank 5 · TkA04G008840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30974DUF877254-76 aa

PF29976vWA_LIC1001260-112 aa

PF13881Rad60-SLD_269-165 aa

PF00240ubiquitin80-143 aa

PF30974DUF877287-122 aa

PF18037Ubiquitin_5117-140 aa

PF08817YukD117-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G008840	`PF30974`	DUF8772	54	76	0.27	12.0
TkA04G008840	`PF29976`	vWA_LIC10012	60	112	0.053	13.7
TkA04G008840	`PF13881`	Rad60-SLD_2	69	165	3.2e-31	108.4
TkA04G008840	`PF00240`	ubiquitin	80	143	3.5e-07	30.6
TkA04G008840	`PF30974`	DUF8772	87	122	0.27	12.0
TkA04G008840	`PF18037`	Ubiquitin_5	117	140	0.019	15.9
TkA04G008840	`PF08817`	YukD	117	143	0.17	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SW27`	Arabidopsis thaliana	sp\|Q9SW27\|MUB3_ARATH Membrane-anchored ubiquitin-fold protein 3	49.500%	Swiss-Prot	Medium
`Q8GWJ6`	Arabidopsis thaliana	sp\|Q8GWJ6\|MUB6_ARATH Membrane-anchored ubiquitin-fold protein 6	53.900%	Swiss-Prot	Medium
`Q6Z8K4`	Oryza sativa subsp. japonica	sp\|Q6Z8K4\|MUB3_ORYSJ Membrane-anchored ubiquitin-fold protein 3	54.500%	Swiss-Prot	Medium
`Q7XRU4`	Oryza sativa subsp. japonica	sp\|Q7XRU4\|MUB4_ORYSJ Membrane-anchored ubiquitin-fold protein 4	47.600%	Swiss-Prot	Medium
`Q75GT2`	Oryza sativa subsp. japonica	sp\|Q75GT2\|MUB1_ORYSJ Membrane-anchored ubiquitin-fold protein 1	49.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card